KEGG   Miniopterus natalensis: 107530288
Entry
107530288         CDS       T05883                                 

Gene name
CHRM4
Definition
(RefSeq) muscarinic acetylcholine receptor M4
  KO
K04132  muscarinic acetylcholine receptor M4
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107530288 (CHRM4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107530288 (CHRM4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107530288 (CHRM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107530288 (CHRM4)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107530288 (CHRM4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 107530288
NCBI-ProteinID: XP_016059462
LinkDB
Position
Unknown
AA seq 477 aa
MANFTPVNGSSANQSVRLVTATHSRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR
QLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIQGYWPLGAVVCDLWLALDYVASNASVM
NLLIISFDRYFCVTKPLTYPARRTTKTAGLMIAAAWVLSFVLWAPAILFWQFVVGERTVP
DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT
LAFLRSPLMKQSAQKPPPEAAREALRNGKPEEAXXXXXXXPPHPVADKDTSNESSSGSAT
QNTKERPTTELSTAEATTPATPAPRLQPRALNPASKWSKIQIVTKQTGNECVTAIEIVPA
TPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVLV
NTFCHSCVPETVWFIGYWLCYVNSTINPACYALCNATFKKTFKHLLLCQYRNIGTAR
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggccaacttcacaccggtcaacggcagctcggccaaccagtctgtgcgcctggtcaca
gcaacccatagccgctacgagacggtggagatggtgttcatcgccacggtgacgggctcg
ctgagcctggtgacggtggtgggcaacatcctggtgatgctgtccatcaaggtcaacagg
cagctgcagacggtcaacaactacttcctgttcagcctggcgtgcgccgacctcatcatc
ggcgccttctccatgaacctctacaccgtgtacatcatccagggctactggcccctgggc
gccgtggtctgcgacctgtggctggccctggactacgtggcgagcaacgcgtcggtcatg
aacctgctcatcatcagcttcgaccgctacttctgcgtcaccaagccgctcacctacccc
gcccggcgcaccaccaagacggccggcctcatgatcgccgccgcctgggtcctgtccttc
gtgctctgggcgcccgccatcctcttctggcagtttgtggtgggcgagcggacggtgcca
gacaaccagtgcttcatccagttcctgtccaacccggcggtgaccttcggcaccgccatc
gcggccttctacctgcccgtggtcatcatgacggtgctctacatccacatctccctggcc
agtcgcagccgcgtccacaagcaccggcccgagggcccgaaggagaagaaggccaagacc
ctggccttcctcaggagccccctgatgaagcagagcgcccagaaacccccgccagaagcc
gctcgggaggcgctgcgcaacgggaagccggaggaggcnnnnnnnnnnnnnnnnnnnncc
ccgccacaccccgtggccgacaaggacacgtccaacgagtccagctcaggcagcgccacc
cagaacaccaaggaacggccaaccacagagctgtcaaccgcagaggccaccacgcccgcc
acgcctgcccctcgcctacagccacgggccctcaacccagcctccaaatggtccaagatc
cagattgtgacgaagcagacaggcaacgagtgtgtgacggccatcgagattgtgcctgcc
acgccggctggcatgcgtccagcagccaacgtggcccgcaaatttgccagtattgcccgc
aaccaggtgcgcaagaagcggcagatggcggcccgggagcgcaaggtgacacggaccatc
tttgccatcctgttggccttcattctcacctggacgccctacaacgttatggtcctagtg
aacaccttctgccacagctgcgtccccgaaactgtgtggttcattggctactggctctgc
tatgtcaacagcaccatcaaccctgcctgctatgccctctgcaatgccacctttaaaaag
accttcaagcacctgctgctatgccagtatcggaacattggcactgccaggtag

DBGET integrated database retrieval system