KEGG   Miniopterus natalensis: 107530341
Entry
107530341         CDS       T05883                                 

Definition
(RefSeq) protein kinase C epsilon type isoform X1
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04071  Sphingolipid signaling pathway
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04530  Tight junction
mna04666  Fc gamma R-mediated phagocytosis
mna04750  Inflammatory mediator regulation of TRP channels
mna04925  Aldosterone synthesis and secretion
mna04930  Type II diabetes mellitus
mna04931  Insulin resistance
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107530341
   04071 Sphingolipid signaling pathway
    107530341
   04022 cGMP-PKG signaling pathway
    107530341
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107530341
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107530341
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107530341
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107530341
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107530341
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107530341
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107530341
   04931 Insulin resistance
    107530341
   04933 AGE-RAGE signaling pathway in diabetic complications
    107530341
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107530341
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107530341
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107530341
SSDB
Motif
Pfam: C1_1 Pkinase PK_Tyr_Ser-Thr C2 C1_2 PP_M1
Other DBs
NCBI-GeneID: 107530341
NCBI-ProteinID: XP_016059572
LinkDB
Position
Unknown
AA seq 551 aa
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGLRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVN
MPHKFSIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKKLPMPFPWCLSEEPSPLNGKLLAGAESPQPASGSSPSE
EDRSKSAPTSPCDQELKELENNIRKALSFDNRGEEHRAAASTDGQLASPGENGEVRQGQA
KRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRIL
ALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSAL
MFLHQHGVIYR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcagtgggactccggccgcagactttccttctggaccct
tacattgccctcaacgtggacgactcgcgcatcggccagacggccacgaagcagaagacc
aacagcccggcctggcacgacgagttcgtcaccgacgtgtgcaacgggcgcaagatcgag
ctggccgtcttccacgacgcccccatcggctacgacgacttcgtggccaactgcaccatc
cagttcgaggagctgctgcagaacgggagccgccacttcgaggactggattgatctggag
ccagaaggcagagtgtatgtgatcatcgatctgtcagggtcgtcgggtgaagcccccaaa
gacaatgaagagcgtgtgttcagggagcgcatgcggcccaggaagcggcagggggccgtc
aggcgcagggtccaccaggtcaacggccacaagttcatggccacctaccttcggcagccc
acctactgctcgcactgcagagatttcatctggggtgtcataggaaagcagggataccaa
tgtcaagtgtgcacttgcgtggtccacaagcgatgccatgagctcataattacgaagtgt
gctggattaaagaaacaggaaactcccgacgaggtgggctcccagcggttcagcgtcaac
atgccccacaagttcagtatccacaactacaaggtccccaccttctgtgaccactgtggg
tccctgctctggggcctcttgcggcagggtctgcagtgcaaagtctgcaagatgaacgtt
caccgccgctgcgagaccaacgtggcccccaactgcggcgtggacgccagaggaatcgcc
aaggtgctggctgacctgggcgtcactcccgacaaaatcaccaacagcggccagaggagg
aaaaagaagctgcccatgccttttccctggtgcctctcagaagagccttctcccttgaat
gggaagctcctcgccggtgcggagtcccctcagcctgcttctggaagctcaccttctgag
gaagatcgatccaagtcagcacccacctccccttgtgaccaggaattaaaagaacttgaa
aacaacatccggaaggccttgtcatttgacaaccgaggggaggagcacagggcggcggca
tccacggacggccagctggcgagccccggcgagaatggtgaagtccggcaaggccaggcc
aagcgcttgggcctggacgagttcaacttcatcaaagtgttgggcaaaggcagctttggc
aaggtcatgttggcggagctcaaaggcaaagacgaagtctatgctgtgaaagttttgaag
aaggacgtcatcctccaggacgatgacgttgactgcaccatgacagagaagcggatcttg
gctctggcgcggaaacacccgtatctaacccaactctattgctgcttccaaaccaaggac
cgcctctttttcgtcatggagtatgtgaatggtggagacctcatgttccagattcagcgc
tcccgaaaattcgacgagccccgttcccggttctacgctgcagaggtcacgtccgccctc
atgttcctccaccaacacggagtcatctacaggtag

DBGET integrated database retrieval system