KEGG   Miniopterus natalensis: 107530403
Entry
107530403         CDS       T05883                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1
  KO
K16366  endothelin-1
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04066  HIF-1 signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
mna04668  TNF signaling pathway
mna04916  Melanogenesis
mna04924  Renin secretion
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05200  Pathways in cancer
mna05410  Hypertrophic cardiomyopathy
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107530403 (EDN1)
   04066 HIF-1 signaling pathway
    107530403 (EDN1)
   04024 cAMP signaling pathway
    107530403 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107530403 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107530403 (EDN1)
   04916 Melanogenesis
    107530403 (EDN1)
   04924 Renin secretion
    107530403 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107530403 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530403 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530403 (EDN1)
   05410 Hypertrophic cardiomyopathy
    107530403 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107530403 (EDN1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 107530403
NCBI-ProteinID: XP_016059654
LinkDB
Position
Unknown
AA seq 194 aa
MDYFPVIFSLLFVAFQGAPETAVLGTELSTYEDSRGEEAFPSAPRRPKRCSCSTLLDKEC
VYFCHLDVIWINTPGKLVPYGLGKPPRAKRSLEDSFLTKATVQGNRCQCANQKDKMCWNF
CQVRRQPRSQDTMEEDWNDQKKEKAFSGLGKKRIHQQLVGGRKMKRSDNHSNRIKASRPK
TGGPQQNVTNNRTH
NT seq 585 nt   +upstreamnt  +downstreamnt
atggattacttccccgtgatcttctccctgctgtttgtggctttccaaggagctccagaa
acagccgtcctgggcaccgagctcagcacctacgaggacagcagaggagaggaggccttt
cccagtgcaccccgccgtcccaagcgctgctcctgctctaccctgctggataaagagtgt
gtctacttctgccacctcgatgtcatctggatcaacactcccgggaaacttgttccatat
ggacttggaaaacctcctagggccaagcgatccttagaggactcatttcttacaaaagca
acagtccaggggaacagatgccagtgtgctaaccaaaaagacaagatgtgctggaatttt
tgccaagtacggagacaacccaggagccaagacactatggaagaagactggaacgatcaa
aagaaagaaaaagccttttcagggcttgggaagaagcgtattcatcagcagctggtggga
ggaaggaaaatgaagaggtcggataaccacagcaacagaatcaaagcttctcgccctaaa
acaggcggcccacagcagaatgtgaccaacaaccgcacacactga

DBGET integrated database retrieval system