KEGG   Miniopterus natalensis: 107530440
Entry
107530440         CDS       T05883                                 

Gene name
CPEB2
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 2 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107530440 (CPEB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107530440 (CPEB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107530440 (CPEB2)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107530440 (CPEB2)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     107530440 (CPEB2)
   mRNA cycle factors
    P-body specific factors
     107530440 (CPEB2)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1 HSP20
Other DBs
NCBI-GeneID: 107530440
NCBI-ProteinID: XP_016059698
LinkDB
Position
Unknown
AA seq 460 aa
MSWGTMHGRDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSAPSLTPKSWIEDNV
FRTDSNSNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLEN
SLIDIMRAEHDPLKGRLSYPHPGTDTLLMLNARSYGRRRARSSLFPIDDGLLDDGHTDQV
GVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESK
SYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFV
MDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAF
SNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCAGKFAPFFCANVTC
LQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgtcctggggaacgatgcacggcagagatcatcgcagaactggaaacatgggaattcca
ggaactatgaatcagatttcccccctgaaaaaaccgttttctggtaatgtcatcgcacca
ccgaagtttactcgctctgctccgtcactgacgccaaaatcttggattgaagacaatgtg
ttcagaacagacagcaatagtaatacactcttacccttacaggtgagatctagtttgcag
ttgccagcttggggctcagattcactccaagatagttggtgcactgcagccggaacatcc
agaatagaccaggatcgaagtagaatgtatgacagtttgaatatgcactctttggaaaat
tcccttattgatattatgagagcagagcatgatcctcttaagggtcgattgagctatccg
catccaggaactgacactctgttgatgttaaatgcaaggagttatgggagaagacgagcc
cgctcttccctcttcccaatcgatgatggcttgctggacgatggccacactgatcaagtt
ggtgttttaaattcacccacgtgttactcagctcatcaaaacggagagcgaatagaacgt
ttctctcgaaaagtttttgttggtggtcttcctccagatattgatgaagatgaaataact
gctagcttcagaagatttgggcctttggtagtagactggcctcataaagcagaaagcaag
tcctattttccaccaaaaggctatgcattccttctctttcaagaagagagctcagttcag
gcactaattgatgcttgcattgaagaagatggaaaactctatctgtgtgtttccagccct
accataaaagacaaaccagttcagatccgtccttggaatttaagtgatagtgattttgta
atggatggttctcagcctctggatccccgaaaaacaatttttgttggaggtgttcctagg
ccactaagggctgtggaacttgctatgatcatggatcggctgtacggtggagtctgttat
gcgggaattgatacagatcctgagctaaaatacccaaaaggtgctggtcgagttgctttc
tccaatcagcagagctacattgctgccatcagtgctcggtttgtgcagcttcagcatggg
gacattgacaaacgcgtggaggtaaagccatacgtgctggatgaccagatgtgtgatgag
tgccagggcgcacgctgtgctggaaaattcgctcctttcttttgtgccaatgtcacttgc
ctgcagtattactgtgagttctgctgggcaaatatccactctcgtgcgggacgtgagttc
cacaagccgttggtaaaggaaggtgctgatcgcccacgtcagatccacttccgctggaac
tag

KEGG   Miniopterus natalensis: 107533909
Entry
107533909         CDS       T05883                                 

Gene name
CPEB4
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 4 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107533909 (CPEB4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107533909 (CPEB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107533909 (CPEB4)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107533909 (CPEB4)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     107533909 (CPEB4)
   mRNA cycle factors
    P-body specific factors
     107533909 (CPEB4)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1
Other DBs
NCBI-GeneID: 107533909
NCBI-ProteinID: XP_016064270
LinkDB
Position
Unknown
AA seq 721 aa
MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAW
LFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQG
DSSSENGSGKEKMRMESPVLTGFDYQEAAGLGTSAQPLTSSASSLTGFSNWSAAIAPSSS
TVINEDASFFHQGGVPAASANNGALLFQNFPHHVSPGFGGSFSPQIGPLSQHHPHHPHFQ
HHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWS
PGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSW
MEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDSIKGRLNYSYPGSDSSLLING
QSSLFPMEDGFLDDGRGDQPLPSGLGSPHCFTHQNGERVERYSRKVFVGGLPPDIDEDEI
TASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSS
PTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVC
YAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCD
ECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW
T
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgggggattacgggtttggagtgctagtgcaaagcaatactgggaataaatctgctttt
ccagtccgattccacccacatctgcagcctccacaccatcaccaaaatgccacccccagc
cctgctgcttttataaataataacacagctgccaatggcagcagtgccgggtcagcttgg
ctcttccctgctccggcgacccacaacatccaggatgagatcctggggtcagaaaaagcc
aaaagtcagcaacaggagcagcaagaccccttggaaaagcagcagctgtcccccagccca
ggtcaggaagctggaatactgcctgaaacggagaaggcaaaatctgaagaaaaccaaggg
gacagctcttcagaaaacggcagtgggaaggagaagatgagaatggagtcaccagtgttg
acagggtttgattaccaagaagctgcagggctaggcacttcggcccagcccttgacgtcc
agcgcctcctctctcactggcttcagtaactggtcagcagccatcgcaccttcctcctcc
acagtcatcaacgaagacgccagtttctttcaccaggggggggtcccagccgcttcggct
aataacggtgctctgttgtttcaaaatttcccccatcatgtcagccctggctttggaggc
agcttctcccctcagatcgggcctctctcccagcaccaccctcatcaccctcacttccag
catcaccacagccagcatcagcagcagaggaggtctcctgccagtccccaccccccgccg
ttcacacacagaaatgctgcttttaaccagctgccgcacttggcgaataatcttaacaaa
cccccctctccatggagcagctaccagagcccctctcctacaccctcttcttcctggagc
cctggaggtggtggatatggtggctggggaggttcccaaggccgcgatcaccgccgaggg
ctgaatggaggaataacgcccctgaactccatctcgcctttgaagaaaaatttcgcaagc
aatcacattcagctccagaagtacgcccgccccagctctgcctttgcgcccaagtcctgg
atggaagacagcctgaacagggctgacaacatcttcccttttccggatcgccccaggaca
ttcgacatgcactccctggagagttcacttattgacataatgagagctgaaaatgattct
attaaaggtcgtctaaactattcatatccaggatccgatagctctctgcttattaatggt
cagtcttcactgtttccaatggaagatggattcttggatgatggccgtggggatcagcct
cttcctagtggcctgggctctcctcactgcttcacgcaccagaatggagaaagagtggag
cggtattcccgcaaggtgttcgtgggcggattgccccctgacatcgatgaagatgagatc
acagctagtttccgtcgcttcggacctttaattgtggattggcctcataaggcagagagc
aaatcctacttccctccgaaaggctatgcattcctgctctttcaagatgaaagctcggtg
caggctctcattgatgcatgcattgaagaagatggaaagctctacctgtgtgtatcaagt
cccactatcaaagacaagccagtacagattcggccctggaacctcagtgacagtgacttt
gtgatggatggttcccaacctctcgacccacggaaaactatatttgttggtggtgttcct
cgacctttacgagcagtggaacttgctatgataatggatcggctgtatggaggcgtgtgc
tatgctgggatcgatacggaccctgagctgaaatacccaaaaggagccgggcgagtcgca
ttctctaatcaacagagctacatagctgctatcagtgcccgctttgttcagctgcagcat
ggagagatagataaacgggtggaagtgaagccatacgtcttggatgatcagctgtgtgat
gaatgtcagggggcccgttgcggggggaagtttgctccatttttctgcgctaatgttacc
tgtctgcagtattactgtgaatattgctgggctgccattcattctcgcgctggcagggag
ttccacaagcccctggtgaaggagggcggcgaccgtccccggcatatttcattccgctgg
acctag

KEGG   Miniopterus natalensis: 107539248
Entry
107539248         CDS       T05883                                 

Gene name
CPEB1
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 1 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107539248 (CPEB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107539248 (CPEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107539248 (CPEB1)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107539248 (CPEB1)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     107539248 (CPEB1)
   mRNA cycle factors
    P-body specific factors
     107539248 (CPEB1)
SSDB
Motif
Pfam: CEBP1_N RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 107539248
NCBI-ProteinID: XP_016071156
LinkDB
Position
Unknown
AA seq 491 aa
MLFPTSAQDSPRGLPDANDLCLGLQSLSLTGWDRPWSTQDADSSAQSSTHSVLSMLHNPL
GSVLGKPPLSFLPLDPLGSDVVDKFPAPSVRGSRLDTWPILDSRSTSPSDSDTSGFSSGS
DHLSDLISSLRISSPLPFLSLAGGGPRDSLKMGVGSRVDQEQAALAAVTPSPTSTSKRWP
GASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSGQLPPRNYKNPVYSCKVFL
GGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRAL
LQACSHDPLSPNGLSEYYFRMSSRRMRCKEVQVVPWVLADSNFVRSPSQRLDPSRTVFVG
ALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFSNQRSYLNAVSAAFVEI
KTTKFTKKVQIDPYLEDSLCHICSTQPGPFFCRDQVCFKYFCRSCWHWRHSSEDLRHHRP
LMRNQKSRDSS
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgcttttccccacctctgcgcaagattctccccggggcctcccagatgcaaatgacttg
tgccttggcctgcagtccctcagcctcacgggctgggaccgaccctggagcacccaggac
gcagattcctcagcccagagcagcacacactcggttctgagcatgctccacaacccactg
ggcagtgtcctggggaagccccccttgagcttcctgccgctggacccccttggatctgac
gtggtggacaagttcccagcaccctcagttagagggtctcgcctggacacatggcccatc
ctggactcccgttccaccagcccctctgactcggacacaagtggcttcagttctggatca
gatcatctttcggatttgatttcaagcctccgcatctcctctcctctgcccttcctgtct
ctggcagggggtggccccagagattctttaaagatgggggttgggtcccgggtggaccaa
gagcaagctgctctcgccgctgtcactccctccccaaccagtacgtcaaagagatggcca
ggagcatctgtgtggccatcctgggacctcctggaagcccccaaggaccccttcagcata
gagagagaggccaggctgcaccggcaggcggcagctgtgaatgaagccacctgtacctgg
agtggccagcttcctccccgcaactacaagaaccccgtctactcctgcaaagtgttcctg
ggaggtgttccctgggatattacggaagctggattggttaacaccttccgtgttttcggc
tctctgagtgtggagtggcccggtaaggatggcaagcacccccggtgccctcccaaaggt
aatatgccgaaagggtacgtgtatctggtcttcgagctggagaagtcagtccgggccttg
ctgcaggcctgctctcatgacccgctgagccccaatggcctgagcgagtactacttcagg
atgtccagccgaaggatgcgctgcaaggaggtacaagtggtcccttgggtcttggccgac
agcaactttgtccggagcccatctcagagactggaccccagcaggacagtgtttgtgggc
gctctgcatgggatgctcaacgccgaggccctggcggccatcctgaatgacctgttcggg
ggagtggtgtacgctgggatcgacacggataagcacaagtatcccatagggtctggtcgt
gtgaccttcagtaaccagcgcagttacctgaacgctgtcagcgctgcttttgtggagatc
aaaaccaccaagttcaccaagaaggttcagattgacccctacctagaggattctctgtgt
cacatctgcagtactcagcccggccctttcttctgtcgagatcaggtgtgcttcaagtac
ttctgccggagctgctggcactggcggcacagctcagaggacctgcgccaccacaggccc
ctcatgcggaaccagaagagccgagactccagctag

KEGG   Miniopterus natalensis: 107543254
Entry
107543254         CDS       T05883                                 

Gene name
CPEB3
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 3
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107543254 (CPEB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107543254 (CPEB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107543254 (CPEB3)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107543254 (CPEB3)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     107543254 (CPEB3)
   mRNA cycle factors
    P-body specific factors
     107543254 (CPEB3)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1 zf-B_box
Other DBs
NCBI-GeneID: 107543254
NCBI-ProteinID: XP_016076205
LinkDB
Position
Unknown
AA seq 649 aa
MQDDLLMDKSKTQPQPQQQQRQQQQQQPQPEPSAAETPSTPLSSETPKPEDSSAVPALSP
AAAPPAPNGPEKMQMESPLLPGLSFHQPPQQPPPPQDPAAPGASLSPSFGSTWSTGTTNA
VEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTHAAAAAASSASSSWNTHQ
SVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNVIAPPKF
PRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKG
KHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMTLNTRSYGRRRGRSSLFPFEDA
FLDDSHGDQSLSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVV
DWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRP
WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKY
PKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFA
PFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgcaggatgatttactgatggacaaaagcaaaacccagccccagccccagcagcagcag
cggcagcagcagcagcagcagccccagcccgagcccagcgcagcagaaaccccgtccacg
cccctctcctcagagacccccaagccggaggacagcagcgcagtgccggcccttagccct
gccgccgccccgccggcccccaacggccccgaaaagatgcagatggaatcgccgctcctg
ccgggcttgagtttccaccagccccctcagcagccgccgccgccgcaggatccagcggcg
ccgggcgcgtcgctgtcgccgtccttcggcagcacctggtccacgggcaccacgaacgcg
gtggaggacagcttcttccaggggatcaccccagtcaacgggaccatgctcttccagaac
ttcccgcaccacgtaaacccagtcttcggaggcaccttctccccgcagatcggcctggcg
cagacccacgcggccgcagctgccgcgtcgtccgcctcgtccagctggaacacgcaccag
agcgtgaatgccgcctggagcgcgccttctaacccctggggcggcctgcaggcgggccgg
gaccctcgccgcgcggtcggcgtgggcgtgggcgtgggcgtcggggtgccttcgccgctc
aaccccatctcgccgctcaaaaaacctttctccagcaatgtgatcgcgccgcccaagttt
ccccgcgcggccccgctcacctccaagtcctggatggaggataacgctttccggaccgat
aatggtaacaatctgttgccatttcaggaccggagtaggccctatgacacttttaacttg
cactcgttggagaactccttaatggatatgataaggactgatcatgagcctctgaaaggt
aaacactaccctcccagtggcccaccaatgagtttcgctgatataatgtggaggaatcat
tttgcaggacgcatgggaatcaatttccatcatccaggaacagataatattatgacactt
aacaccaggagctatgggcggagacgaggtcggtcttctctctttccctttgaagatgcc
ttccttgatgacagtcatggtgatcagtccttgtcatctggcttaagttctcccactcgc
tgtcaaaatggggagcgagtagaacgctactctagaaaggtgtttgttggaggccttcct
cctgacatcgacgaagatgagatcactgccagctttcgcaggtttggacctctcgttgta
gactggcctcacaaagctgaaagcaagtcgtattttcctcctaaaggctatgcctttctg
ctgttccaggaggagagctcagtgcaagctttgatagatgcctgcctagaagaagatggg
aagctgtacctgtgcgtgtcaagccccaccatcaaggacaaaccggtgcaaattcgacca
tggaacctaagtgacagtgactttgtaatggatggttctcagcctttggaccccagaaaa
actatctttgttgggggagttccacgaccccttcgagctgttgaactggcaatgatcatg
gaccgtttgtatggtggtgtctgctatgctggcatcgatacagacccagagctgaagtac
cccaaaggtgctggccgcgtggcgttctccaaccagcagagttacatcgcagccatcagc
gctcgctttgtgcaactccaacacaatgacattgacaaacgggtggaagtgaagccatac
gtgctggatgatcagatgtgtgacgagtgccagggcacgcgctgcggcgggaagttcgcc
cccttcttctgtgccaacgtcacctgtctgcagtattactgcgaatactgctgggcgagc
atccactcccgcgccgggcgggagttccacaaaccgctggtgaaggagggaggcgaccgc
cctcggcacgtcccgttccgctggagctga

DBGET integrated database retrieval system