KEGG   Miniopterus natalensis: 107530468
Entry
107530468         CDS       T05883                                 

Gene name
KCNJ5
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 4
  KO
K04999  potassium inwardly-rectifying channel subfamily J member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04915  Estrogen signaling pathway
mna04921  Oxytocin signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04929  GnRH secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107530468 (KCNJ5)
   04915 Estrogen signaling pathway
    107530468 (KCNJ5)
   04921 Oxytocin signaling pathway
    107530468 (KCNJ5)
   04925 Aldosterone synthesis and secretion
    107530468 (KCNJ5)
  09156 Nervous system
   04728 Dopaminergic synapse
    107530468 (KCNJ5)
   04726 Serotonergic synapse
    107530468 (KCNJ5)
   04723 Retrograde endocannabinoid signaling
    107530468 (KCNJ5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107530468 (KCNJ5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107530468 (KCNJ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107530468 (KCNJ5)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107530468 (KCNJ5)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 107530468
NCBI-ProteinID: XP_016059726
LinkDB
Position
Unknown
AA seq 362 aa
MEKTGKCNVHHGNVRETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFLWWLIAY
ARGDLEHVGDREWVPCVENLSGFVSAFLFSIETETTIGYGFRVITEQCAEGIALLMVQAI
LGSIVNAFMVGCMFVKISQPKKRAETLMFSHHAVISLRDDRLCLMFRVGDLRSSHIVEAS
IRAKLIQSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQ
LGQEEFEIVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHD
TYETNTPSCCAKELAEMKREGRLFPYLLPGSCANAELEAEAEQDREDEPEALNGTQETRG
LV
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggagaagacgggcaagtgcaacgtgcaccacggcaacgtgcgcgagacctaccgctac
ctgagcgacctgttcaccacgctcgtggacctcaagtggcgcttcaacctgctggtcttc
accatggtctacaccgtcacctggctcttcttcggcttcctctggtggctcatcgcctac
gcgcggggcgacctggagcacgtgggggaccgcgagtgggtgccgtgcgtggagaacctc
agcggcttcgtgtccgccttcctgttctccatcgagacggagaccaccatcggctacggc
ttccgcgtgatcacggagcagtgcgccgagggcatcgcgctgctcatggtgcaggccatc
ctgggctccatcgtcaacgccttcatggtcggctgcatgttcgtgaagatcagccagccc
aagaagcgcgccgagacgctcatgttctcccaccacgcggtcatctcgctgcgcgacgac
aggctctgcctcatgttccgcgtgggcgacctgcgcagctcgcacatcgtggaggcctcc
atccgcgccaagctcatccagtcgcggcagaccaaggagggggagttcatccccctcaac
cagacggacatcaacgtgggcttcgacacgggcgacgaccgcctcttcctcgtgtcgccg
ctcatcatctcccacgagatcaatgagaagagccccttctgggagatgtctcgcgcccag
ctgggccaggaggagttcgaaatcgtggtcatcctggaagggatggtggaggccacaggc
atgacgtgccaagcacggagctcctacatggatacagaggtgctctggggccaccggttc
acaccagtcctcaccttggagaaaggcttctatgaggtggactataacaccttccatgac
acctatgagaccaacacgcccagctgctgtgccaaggagctggcggaaatgaagcgggaa
ggccggcttttcccatacctcctgccgggcagctgtgctaacgcggagctggaggcagag
gctgagcaggaccgagaggatgagcccgaggcgctgaatgggacccaggagaccaggggc
ttggtgtga

KEGG   Miniopterus natalensis: 107537431
Entry
107537431         CDS       T05883                                 

Gene name
KCNJ3
Definition
(RefSeq) LOW QUALITY PROTEIN: G protein-activated inward rectifier potassium channel 1
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
mna  Miniopterus natalensis
Pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04915  Estrogen signaling pathway
mna04921  Oxytocin signaling pathway
mna04929  GnRH secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107537431 (KCNJ3)
   04915 Estrogen signaling pathway
    107537431 (KCNJ3)
   04921 Oxytocin signaling pathway
    107537431 (KCNJ3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107537431 (KCNJ3)
   04725 Cholinergic synapse
    107537431 (KCNJ3)
   04728 Dopaminergic synapse
    107537431 (KCNJ3)
   04726 Serotonergic synapse
    107537431 (KCNJ3)
   04723 Retrograde endocannabinoid signaling
    107537431 (KCNJ3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107537431 (KCNJ3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107537431 (KCNJ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537431 (KCNJ3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107537431 (KCNJ3)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 107537431
NCBI-ProteinID: XP_016072524
LinkDB
Position
Unknown
AA seq 497 aa
MSALRRKFGEDYQVVTTSSSGSGLQPQGPQQQLAPRKKRQRFVDKNGRCNVQHGNLGSET
SRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCV
ANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKM
SQPKKRAETLMFSEYAVISMRDGKLTLMFRVGNLRNSHMVSAQIXCVLVXSRQTPEGEFL
PLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQSEQFEIVVILEGIVE
TTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEM
LLMSSPLIAPAITNSKERHNSVDCLDGIEDISTKLPSKLQKMTGREDFPRKLLRMSSTTS
EKAYSLGDLPMKLQRISSVPGNSEEKLVSKATKMLSDPMSQSVADLPPKLQRMAGGGARM
EGNLPAKLRKMNSDRFT
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggaagattaccaggtagtcaccacctcgtccagc
ggctcgggcttgcagccccagggcccgcagcagcagctcgcgcccaggaagaagcggcag
cggttcgtggacaagaacggccggtgcaatgtgcagcacggcaacctgggcagcgagacg
agccgctacctttcggacctcttcaccacgctggtggacctcaagtggcgctggaacctc
ttcatcttcatcctcacctacaccgtggcctggctcttcatggcgtccatgtggtgggtg
atcgcctacacgcggggcgacctcaacaaagcgcacgtcggcaactacacgccctgcgtg
gccaacgtctacaacttcccgtccgcctttctcttcttcatcgagaccgaggccaccatc
ggctacggctaccgctacatcaccgacaagtgccccgagggcatcatcctcttcctcttc
cagtccatcctcggctccatcgtggacgccttcctcatcggctgcatgttcatcaagatg
tcccagcccaagaagcgcgcggagaccctcatgttcagcgagtacgcggtgatttccatg
cgggacggaaaactcacgctcatgttccgggtgggcaacctgcgcaacagccacatggtc
tccgcgcagatccnctgtgtgcttgtctagtctcggcagacacctgagggtgagttcctt
ccccttgatcaacttgaactggatgtaggttttagtacaggggcagatcaactttttctt
gtttcccccctcacgatttgccacgtgatcgatgccaaaagccccttttatgacctgtcc
cagcgaagcatgcaaagtgagcagttcgagattgtcgtcatcctagaaggcattgtggaa
accactgggatgacttgtcaagctcgaacgtcatatactgaagatgaagttctttggggt
catcgcttttttcctgtgatttccttagaagaagggttctttaaagttgattactcccag
ttccacgcaacatttgaagttcccaccccaccttacagtgtgaaagaacaggaggaaatg
cttcttatgtcgtcccccttaatagcaccagccataactaacagcaaagaaagacataat
tctgtagactgcttagatggaatagaagacattagtacaaaacttccatctaagctgcag
aaaatgactggaagagaagacttccccagaaaactcttgaggatgagttctacaacttca
gaaaaagcctacagcttgggagatttgcccatgaaacttcaacgaataagctcagttcct
ggcaactcagaggaaaaactggtatctaaagccaccaaaatgttgtctgatcccatgagc
cagtcagtggctgatttgccaccaaagcttcaaaggatggctgggggaggagccaggatg
gaaggaaatcttccagccaaattaaggaaaatgaactctgatcgattcacataa

KEGG   Miniopterus natalensis: 107543277
Entry
107543277         CDS       T05883                                 

Gene name
KCNJ6
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 2
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
mna  Miniopterus natalensis
Pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04915  Estrogen signaling pathway
mna04921  Oxytocin signaling pathway
mna04929  GnRH secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107543277 (KCNJ6)
   04915 Estrogen signaling pathway
    107543277 (KCNJ6)
   04921 Oxytocin signaling pathway
    107543277 (KCNJ6)
  09156 Nervous system
   04727 GABAergic synapse
    107543277 (KCNJ6)
   04725 Cholinergic synapse
    107543277 (KCNJ6)
   04728 Dopaminergic synapse
    107543277 (KCNJ6)
   04726 Serotonergic synapse
    107543277 (KCNJ6)
   04723 Retrograde endocannabinoid signaling
    107543277 (KCNJ6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107543277 (KCNJ6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107543277 (KCNJ6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107543277 (KCNJ6)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107543277 (KCNJ6)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 107543277
NCBI-ProteinID: XP_016076231
LinkDB
Position
Unknown
AA seq 423 aa
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHICRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLVQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSMSSKLNQHAELETEEEEKNLEEQTERNGDVANLEDE
SKV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggccaagctgacagaatccatgactaacgtcctggagggcgactccatggatcaggac
gtggagagccctgtggccattcaccagccaaagttgcctaagcaggccagggacgacctg
ccaagacacatctgccgagaccggaccaaaaggaaaatccagaggtatgtgcggaaagac
gggaagtgcaacgtccaccatggcaacgtgcgggagacctaccgctacctgaccgacatc
ttcaccaccttggtggacctcaagtggaggttcaacctgttgattttcgtcatggtttac
acagtgacgtggctcttttttgggatgatctggtggctaatcgcgtacatccgaggagat
atggaccacatcgaggacccctcgtggactccctgcgtcaccaacctcaacgggttcgtc
tctgcttttttattttcaatagagacagaaaccaccatcggttatggctaccgggtcatc
acggacaagtgcccggagggaattattctgctcttagtccagtctgtgctggggtccatt
gtcaatgcattcatggtgggatgcatgtttgtaaaaatatcgcaacccaagaagagggca
gagacccttgtgttttccacccacgcggtgatctccatgcgggacgggaaactgtgcctg
atgtttcgagtcggggatctcaggaattcccacatcgtggaggcttccatcagagccaag
ttgatcaaatccaaacagacctcagagggcgagttcatccctttgaaccagacggatatc
aatgtagggtactacaccggggatgatcgtctgtttctggtgtcaccgctcatcatcagt
catgaaattaaccaacagagtcctttctgggaaatctccaaagcccagctgcccaaagag
gaactggaaattgtggtcatcctagaaggaatggtggaagctacaggaatgacgtgccaa
gctcggagctcctacatcaccagtgagatcctgtggggttaccggttcaccccagtcctg
acgctggaagacgggttctacgaagtcgattacaacagcttccacgagacctacgagacc
agcacaccctccctcagtgccaaagagctggccgagctggccagcagggcagagctgccc
ctcagttggtccatgtccagcaaactcaaccaacatgcagaactggagacagaagaggaa
gaaaagaacctcgaggagcaaacagaaaggaatggtgacgtggccaacctcgaggatgag
tccaaagtgtag

DBGET integrated database retrieval system