KEGG   Miniopterus natalensis: 107530545
Entry
107530545         CDS       T05883                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04015  Rap1 signaling pathway
mna04062  Chemokine signaling pathway
mna04510  Focal adhesion
mna04666  Fc gamma R-mediated phagocytosis
mna04722  Neurotrophin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05211  Renal cell carcinoma
mna05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107530545 (CRKL)
   04012 ErbB signaling pathway
    107530545 (CRKL)
   04015 Rap1 signaling pathway
    107530545 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107530545 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107530545 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107530545 (CRKL)
   04062 Chemokine signaling pathway
    107530545 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107530545 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    107530545 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107530545 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107530545 (CRKL)
   05206 MicroRNAs in cancer
    107530545 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107530545 (CRKL)
   05211 Renal cell carcinoma
    107530545 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107530545 (CRKL)
   05100 Bacterial invasion of epithelial cells
    107530545 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107530545 (CRKL)
   05163 Human cytomegalovirus infection
    107530545 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107530545 (CRKL)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   107530545 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 107530545
NCBI-ProteinID: XP_016059814
LinkDB
Position
Unknown
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRIGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSSTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgctaggttcgactcctcagaccgctccgcctggtacatggggccagtgtct
cgtcaggaggcgcagacccggctccagggccagcgccacggcatgttcctagtccgcgac
tcctccacctgccccggggactatgtgctgtccgtgtccgagaactcgcgggtctcccac
tacatcatcaactcactgcccaaccgccgttttaagatcggggaccaggagtttgaccac
ttgccggccctgctggagttctacaagattcactacctggacaccaccaccctaatcgag
cccgcgcccaggtatccaagcccaccaatgggatctgtatcagcacccaacctgcctaca
gcagaggaaaatctggaatatgtacggactctctatgattttcctgggaatgatgctgaa
gacctgccctttaaaaaaggtgagatcctggtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggacggccggattgggatgattcccgtcccttatgttgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcacgcatatgctcaacctcagaccacgactcctctacctgcagtttcc
agtactccaggggcagcaatcaaccctttgccatccacacagaatggacctgtctttgca
aaggcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgatattgtgaaagtcacaaggatgaacataaatggccagtgggaaggtgaagtgaat
gggcgcaaagggctttttccctttacacacgtcaaaatctttgaccctcaaaacccagat
gaaaatgagtga

KEGG   Miniopterus natalensis: 107535608
Entry
107535608         CDS       T05883                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04015  Rap1 signaling pathway
mna04062  Chemokine signaling pathway
mna04510  Focal adhesion
mna04666  Fc gamma R-mediated phagocytosis
mna04722  Neurotrophin signaling pathway
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05211  Renal cell carcinoma
mna05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107535608 (CRK)
   04012 ErbB signaling pathway
    107535608 (CRK)
   04015 Rap1 signaling pathway
    107535608 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107535608 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107535608 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107535608 (CRK)
   04062 Chemokine signaling pathway
    107535608 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107535608 (CRK)
   04935 Growth hormone synthesis, secretion and action
    107535608 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107535608 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535608 (CRK)
   05206 MicroRNAs in cancer
    107535608 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107535608 (CRK)
   05211 Renal cell carcinoma
    107535608 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107535608 (CRK)
   05100 Bacterial invasion of epithelial cells
    107535608 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107535608 (CRK)
   05163 Human cytomegalovirus infection
    107535608 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107535608 (CRK)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   107535608 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 107535608
NCBI-ProteinID: XP_016066599
LinkDB
Position
Unknown
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQDAVMMLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGASPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEETEYVRALFDFNGNDEEDLPFKKGDILKIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPGSASVSAMIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggttgagccgg
caggatgcggtgatgatgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccaccggtgccaccgtcgcccgcccagcctccgccc
ggggcgagcccctccagactccgaataggagatcaagagtttgactcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccagg
tccaggcagggtagtggagtgattctcaggcaagaggagacagagtatgtgcgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaaa
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggcaagaggggg
atgattccagtcccttacgtggagaagtatagacctggctccgcctcagtatcggctatg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtcagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaaccctgat
gaggacttcagctga

DBGET integrated database retrieval system