KEGG   Miniopterus natalensis: 107530741
Entry
107530741         CDS       T05883                                 

Gene name
NPPC
Definition
(RefSeq) C-type natriuretic peptide
  KO
K12336  natriuretic peptide C
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107530741 (NPPC)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107530741 (NPPC)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530741 (NPPC)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 107530741
NCBI-ProteinID: XP_016060122
LinkDB
Position
Unknown
AA seq 123 aa
MHLSQLLACALLLTLLSLWPSEAKPGAQPKVPRAPLGEVSAASHAEGVGQKKRDKIPGGG
GSNLRGDQARLLRDLRVDTKSRWVRLLQENPNARKHKGSKKGTSKGCFGLKLDRIGSTSG
LGC
NT seq 372 nt   +upstreamnt  +downstreamnt
atgcacctctcccagctgctggcctgcgccctgctgctcaccctcctctcgctctggccc
tctgaagccaagcccggggcgcagccgaaggtcccgcgagctccgctaggggaggtgtca
gccgcgtcccatgctgagggcgtcggtcagaagaagcgcgacaagattcccggaggcggt
ggctccaacctcaggggcgaccaggcgcgactgctccgggacctgcgcgtggacaccaag
tctcgatgggtccgcctcctgcaggagaaccccaacgctcgcaaacacaaaggcagcaag
aagggcacgtccaagggctgcttcggcctcaagctggaccggatcggctccaccagcggc
ctgggatgttag

KEGG   Miniopterus natalensis: 107530742
Entry
107530742         CDS       T05883                                 

Definition
(RefSeq) C-type natriuretic peptide-like
  KO
K12336  natriuretic peptide C
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107530742
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107530742
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530742
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 107530742
NCBI-ProteinID: XP_016060123
LinkDB
Position
Unknown
AA seq 123 aa
MHLSQLLACALLLTLLSLWPSEAKPGAQPKVPRAPLGEVSAASHAEGVGQKKRDKIPGGG
GSNLRGDQARLLRDLRVDTKSRWVRLLQENPNARKHKGSKKGTSKGCFGLKLDRIGSTSG
LGC
NT seq 372 nt   +upstreamnt  +downstreamnt
atgcacctctcccagctgctggcctgcgccctgctgctcaccctcctctcgctctggccc
tctgaagccaagcccggggcgcagccgaaggtcccgcgagctccgctaggggaggtgtca
gccgcgtcccatgctgagggcgtcggtcagaagaagcgcgacaagattcccggaggcggt
ggctccaacctcaggggcgaccaggcgcgactgctccgggacctgcgcgtggacaccaag
tctcgatgggtccgcctcctgcaggagaaccccaacgctcgcaaacacaaaggcagcaag
aagggcacgtccaagggctgcttcggcctcaagctggaccggatcggctccaccagcggc
ctgggatgttag

DBGET integrated database retrieval system