KEGG   Miniopterus natalensis: 107530834
Entry
107530834         CDS       T05883                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04611  Platelet activation
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
mna05132  Salmonella infection
mna05145  Toxoplasmosis
mna05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107530834 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107530834 (PIK3CG)
   04072 Phospholipase D signaling pathway
    107530834 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    107530834 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    107530834 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107530834 (PIK3CG)
   04062 Chemokine signaling pathway
    107530834 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107530834 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107530834 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    107530834 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107530834 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107530834 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107530834 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107530834 (PIK3CG)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107530834 (PIK3CG)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107530834 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 Myc-LZ
Other DBs
NCBI-GeneID: 107530834
NCBI-ProteinID: XP_016060239
LinkDB
Position
Unknown
AA seq 1102 aa
MELGSRDQPVVLREDNRRRRRRMKPRGSAASLPSMELIAVEFVLPTSQRSSKTPETVLLH
VAGHGNVEQMKAQVWLRALETSAAADFYQRLSPDQFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHKSPGQIHVVQRRPPLEDTLAFQRQLTALMGYDVTDVSNVHDDELEFTRRRL
LTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIFIVIHRSTTSQTVKVLADDT
PATILQSFFTKMAKKKSLMDIPESQNERDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHLVLDTPPDPAQDEVRREEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASAETPSSESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQISGKGEDQESFNADKLTSATNPDKENSMSICILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLEGLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNSNLP
KSFRVPYDPGLKAGALVVEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCTKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctgggcagccgtgaccagcccgtggttctgagggaggacaaccgccgccggcgc
cgcaggatgaagccgcgcggctcggccgccagcctgccctccatggagctcatcgccgtc
gagttcgtgctgcccaccagccagcgcagcagcaagacgccggagaccgtgctgctgcac
gtggccggccacgggaacgtggagcagatgaaggcgcaggtgtggctccgcgcgctggag
acgagcgcggcggccgacttctaccagcggctcagcccggaccagttcctgctgctctac
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagacgctggac
tgcctgcgctactggaaggtgctgcacaagagcccggggcagatccacgtggtgcagcgc
cgcccgcccctggaggacacgctggccttccagcggcagctcacggcgctcatgggctac
gacgtcaccgacgtcagcaacgtgcacgacgacgagctggagttcacgcgccgccgcctg
ctgaccccgcgcatggcggaggtggccggccgcgaccccaagctctacgccatgcacccc
tgggtgacgtccaagccgctccccgagtacctgctgaagaagattaccaacaactgcatc
ttcatcgtcattcaccgcagcaccaccagccagaccgtcaaggtcttggccgatgacacc
ccagccaccatcctccagagcttcttcaccaagatggcgaagaagaagtccctcatggac
atccccgaaagccaaaacgaacgggacttcgtgctgcgcgtgtgtggccgcgatgagtac
ctggtgggtgagacgcccatcaagaacttccagtgggtgaggcactgcctcaagaacggc
gaggagatccacctggtgctggacacgcctccggacccggcccaggacgaggtgaggaga
gaagagtggccgctggtggatgactgcacaggggtcaccggctaccatgagcaactgacc
atccacgggaaggaccacgagagcgtgttcaccgtgtccttgtgggactgtgaccggaag
ttcagggtcaaaatcagaggcattgatatccccgtcctgccccgaaacgctgacctcacg
gtgttcgtggaggcaaacatccagcacgggcagcaggtcctttgccaaaggagaaccagc
cccaaacccttcacggaggaggtgctctggaacgtgtggctcgagttcagcatcaaaatc
aaagacttacccaaaggggctctactgaacctccagatctactgcggcaaagccccagcg
ctgtctggtaaggcctctgcagagactcccagttctgaatccagaggcaaagctcagctt
ctctattatgtgaacttgctgctcatagaccaccggttcctcctgcgccacggggaatac
gtgctccacatgtggcaaatatctgggaagggagaagaccaagagagcttcaatgctgac
aagctcacgtcagcaaccaacccagacaaggagaattcaatgtccatctgcattcttctg
gacaattactgtcaccccatagccttgcctaagcatcggcccacccctgaccccgaaggg
gaccgggttcgagcggaaatgcccaaccagcttcggaagcaactggaggcgatcatagcc
actgatccacttaaccctctcacagccgaagacaaagaattgctctggcatttcagatat
gaaagccttaagcatccaaaagcatatcctaagctatttagctcagtgaaatggggacag
caagaaattgtggccaaaacataccaattgctagccagaagggaggtctgggatcaaagt
gctttggatgttgggctgacaatgcaactcttggactgcaacttttcagatgaaaatgta
agagccattgcagttcagaaactggagggcctggaggatgatgatgttctgcattacctg
ctacagctggtccaggctgtgaaatttgaaccttaccatgacagtgcccttgccagattt
ctactgaagcgtggtctaagaaacaaaagaattggtcacttcttgttttggttcttgaga
agtgagatagcccagtccaggcactatcagcagaggttcgctgtgatcctggaagcctac
ctgaggggctgtggcactgccatgctgcacgactttacccagcaagtccaagtaattgag
atgttacagaaagttaccattgatattaaatctctttctgctgaaaagtatgacgtcagt
tcccaagttatttcacaacttaagcaaaagcttgaaaacctacagaattcgaatctcccc
aagagctttagagttccatatgatcctggactaaaagcaggagcactggtggttgaaaaa
tgtaaagtgatggcctccaagaaaaaacccctgtggcttgagtttaaatgtgccgaccct
acagctctatcgaatgaaacaattggaattatttttaaacatggtgatgatctgcgccaa
gacatgcttattttacagattctacgaatcatggagtccatttgggaaactgaatctttg
gatctatgcctcctgccatacggttgcatttcaactggtgacaaaataggaatgatcgag
attgtgaaagatgccacaacaattgccaaaattcagcaaagcacagtgggcaacacaggt
gcatttaaagatgaagtactgaatcactggctcaaagaaaaatgccctattgaagagaag
tttcaggctgcagtggagagatttgtttattcctgtgccggctactgtgtggcaaccttt
gttcttggaataggtgaccggcacaatgacaacattatgattacagagacaggaaatcta
tttcatattgactttgggcatattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaaccccagacttcctgttcgtgatgggaacttctggaaag
aagacaagcctacacttccagaaatttcaggatgtctgcactaaggcttatctagccctt
cgtcatcacacaaacctactgatcatcttgttctccatgatgctgatgacaggaatgccg
cagttaacaagcaaagaagatattgaatatattcgggatgccctaacagtggggaaaaat
gaggaggatgctaaaaagtattttcttgatcagattgaagtttgcagagacaaaggatgg
accgtgcagtttaactggttcctacatcttgttcttggcatcaaacaaggagagaaacat
tcagcctaa

KEGG   Miniopterus natalensis: 107544506
Entry
107544506         CDS       T05883                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04611  Platelet activation
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
mna05145  Toxoplasmosis
mna05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107544506 (PIK3R6)
   04072 Phospholipase D signaling pathway
    107544506 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    107544506 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    107544506 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107544506 (PIK3R6)
   04062 Chemokine signaling pathway
    107544506 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107544506 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107544506 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    107544506 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544506 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107544506 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544506 (PIK3R6)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107544506 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 107544506
NCBI-ProteinID: XP_016077891
LinkDB
Position
Unknown
AA seq 706 aa
MESSDVELDLQRSVQAVLRELSAQAPALRSNRGMWRWSLHKKIDRDPGKSPVLVRILLRE
LEKAEHEDGRRVIIPLLHTLMYVLTKATGISEELYQRTYAFCMRLLTLPAPYCTVALDCA
IKLKTETAAPGTLYQRLVIAEQNLRSELYPYQERVFLFVDPELVSPSVCSALLLEIQAAQ
TQQTPEACMRHVVAHTLQAALGGACRADTLQRKLQPDSSDPLPDRPPSIPLPSPHITLHL
WTDEEQLWKELVLFLYPKSQAHLSADLEALDLQGLLQDREQARVSVLSTDSGIERDLPSG
SDELPIPSSPETEHARLQRKGGMKKRVWPPDISNWDGPPGLHRSTGRPSGDGELLPGVSR
LHTARVLVLGDDRMLGRLARAYHNLRKQETKTFCLTPRLSLQLYYIPVLTPEKPPSSRHL
EFGELAAFLGRADPWYESTVNTLCPAIQKLAEMPPSLDTSQTVDPFILDVITYYVRMGTQ
PIYFQIYTVKIFFRDLSQDSAEDIFLTELKVKIQDSKLPKDGFSPRRRGAAEAPGAELSL
CYQKALLSHRTREVTISLRATGLVLKALPASDTDVLPVSRPPTPPPITVAPLTDHTCLSV
NVTEVVKSSNLAGRSFSTVTNTFRTANVQIQSQDQRLLTLWLDKDHRRTFRDVTRFEVAP
CPEPCSGAQKSKTLWLSSHQQKEMETTKAMPKPLLMPINTFSGIVQ
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggagagttcagatgtggagctggacctccagcggagcgtgcaggctgtgctccgggag
ctcagtgcccaggccccggccctgcggagcaaccgaggcatgtggagatggtccctgcac
aagaagatagaccgagatcctggtaagagtccggtgctggtccgcattctgctcagagaa
ctggaaaaggcagagcacgaggacggccggcgggtcatcattcccctgctgcacacgcta
atgtacgtgctcaccaaggccacaggcatctccgaggagctctaccagaggacctacgcc
ttctgcatgcggctgctgaccctgcccgccccctactgcacggtcgccctggactgcgcc
ataaagctgaaaacggagacggctgccccagggacgctgtaccagaggctggtcattgcc
gagcagaacttgaggagtgaactgtatccctaccaggagagagtgttcctcttcgtggat
cctgagctggtgtctccctccgtgtgcagtgccctgctgctggagatccaggcagcccag
acacagcagacgcccgaggcctgcatgcgccacgtggtcgcccacaccctgcaggcagct
ctgggtggggcctgccgagccgacaccctgcagaggaagctgcagccggactccagtgac
cccctcccagaccggccaccaagcatccccctgcccagtccacacatcacgctccacctg
tggaccgacgaggagcagctctggaaggaactggtgctcttcctgtacccgaaatcccaa
gcacacctcagcgctgacttggaggccttggatctgcagggcctcctgcaggaccgggag
caagcccgggtgtccgtgctgtccactgacagtggcattgagcgggaccttccttcggga
tccgacgagctgcccatacccagcagccctgagacggagcacgccaggctgcagcgcaaa
gggggaatgaagaagcgcgtgtggcccccggacatcagcaactgggacgggcccccgggg
cttcaccggagcacaggcaggcccagtggggatggagaactgctacccggtgtctcccgg
ctgcacacggcccgggtgctggtgctgggggacgacaggatgctggggcgcctggcccgg
gcctaccacaacctcaggaaacaagagacgaagacattctgcctcactcccagactcagc
ctgcagctctactacatccctgtgctgacaccagagaagcccccatcgtccaggcacttg
gagttcggagagctggccgcgttcctgggccgcgcagacccgtggtacgagagcaccgtc
aacaccctgtgcccggccatccagaagctggcagagatgcctccctccctggacacgtcc
cagactgtagaccccttcatcctggatgtcatcacttactatgtccgcatgggcacccaa
cccatctatttccagatctacacagtcaagatcttcttccgagacctgagccaagactct
gcagaggacattttccttaccgagctgaaggtgaagatccaagactccaaactccccaaa
gatggcttctcgcccaggcggagaggcgcggccgaggccccgggggccgagctgtccctg
tgctaccagaaggccctgctcagccaccggacccgagaggttaccatttccctgagggcc
accgggctggtcctgaaggcccttccagccagtgacactgacgtccttcccgtttcaagg
ccacccactcctcctcccatcactgttgctccccttacagaccacacgtgcctgagtgtt
aacgtgacggaggttgtcaagtcgtccaacttggcaggaaggtccttctctacagtgaca
aacaccttccgcacggcaaacgtccagatccagagccaggaccagaggctgctgacactg
tggctggacaaggaccatcggcgcactttcagggatgtgaccagattcgaggttgctccc
tgcccagagccatgttccggggctcagaagtccaagacgctatggctcagttcacaccag
cagaaggagatggaaacgaccaaagccatgcccaagccccttctaatgcccatcaacacg
ttctccggcatcgtccaatga

KEGG   Miniopterus natalensis: 107544531
Entry
107544531         CDS       T05883                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04371  Apelin signaling pathway
mna04611  Platelet activation
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
mna05145  Toxoplasmosis
mna05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107544531 (PIK3R5)
   04072 Phospholipase D signaling pathway
    107544531 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    107544531 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    107544531 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107544531 (PIK3R5)
   04062 Chemokine signaling pathway
    107544531 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107544531 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107544531 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    107544531 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107544531 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107544531 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544531 (PIK3R5)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107544531 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101 Sporozoite_P67 BUD22
Other DBs
NCBI-GeneID: 107544531
NCBI-ProteinID: XP_016077921
LinkDB
Position
Unknown
AA seq 883 aa
MQPGATTCTEDRILHALERCLHGLSFNRRRSTSWSAGLCLNCWSLQELVSRDPGHFLILL
EQILQKTREVQKEGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAARTYHQFLTWPVPY
SSISQELLTFIDAELKAPGISYQRLVRAEQGLPIRNHRSSTVTVLLLNPVEVQAEFLAVA
NKLSTPGHSPHSAYITLLLHAFQATFGAHCDLPGLHSRLQSKTLAELEDIFTETAEAQEL
ASGIGDAAEARRWLRAKLKAVGEKAGFPDVLDTAKPCKLRTIPIPVARCYTYSWNQDSFD
VLQEILLKEQELLQPGLLGDDYDDEEEEEEEEGEEEDLETDAQCAKRDSLLSTSSEASRD
SALSLASSQASGSTLSRQLLTSFVSGLSDGVDSGYVEDSEESSPEWPRRPGSQERRGHRR
PGQKFNRIYKLFKSTSQLVLRRDSRGLEGSSDTAPPLRRAGSLCSPLGSPALPPARAQRS
RSLPQPKLSTQLPSWLLAPASRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYS
NLRQLESNRPLLSRFFKLQFFYVPVKRSQGTSSSTPATLSQTPLLPPDSPRHPSPAELGP
AQWEESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKVDSRPLEGSPSQLPILAD
MLLYYCRFAARPVLLQVYQTELTFITGEKTSEIFIHSLELGHSAATRAIKASGPGSKRLG
IDGDREAVPLTLQIIYSKGAISGRSRWSNMEKVCTSINLNKACRKQEELDSGIEALTLNL
TEVVKRQNPKSKKGFNQISTSQIKVDKVQIIGSRSCPFAVCLDQDERKILQSVVRCEVSP
CYKPEKSNLCPQPQRSPHPLAQAPPDLCSLLCLPIMTFSGALP
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgcagccaggggccacaacgtgcacagaggaccgcatcctgcacgccctggagcgctgc
ttgcacggactcagcttcaaccgccgccgctccacctcctggtcagccgggctgtgtctg
aactgctggagcctgcaggagctggtcagcagggacccaggtcacttcctcatcctcctg
gagcagatactgcagaaaacacgagaggtccagaaggagggcacctatgacctcctcacc
cccctggccctgctcttctactccactgtcctctgcacaccacacttcccgccagactcg
gatctccttctgaaagcagccagaacctaccaccagttcctgacctggcccgtcccttac
agcagcatcagccaggagctgctcaccttcatcgatgctgagctcaaggccccaggaatc
tcctaccagcgactggtgagggctgagcagggcctgcccattcggaatcaccgcagctcc
actgtcaccgtactgctgctgaacccggtggaggtgcaggcagagttcctcgccgtggcc
aacaagctgagcacgcccgggcactcaccgcatagcgcctacatcaccctgctcctgcat
gccttccaggccacctttggggcccactgtgacctcccaggtctgcacagtaggctgcag
tccaagaccctggcagagctcgaggatatcttcacggagactgcagaggcacaggagctg
gcatctggcatcggggatgcggccgaggcccggaggtggctcagggccaagctgaaggcc
gtgggagagaaagctggcttccctgatgtcttagatactgccaagccctgcaagctgcgc
accattcccatccctgtggccaggtgctacacctacagctggaaccaggacagctttgat
gtcctgcaggagatcctgctcaaggaacaggagctgctgcagccggggctcctgggggac
gactacgacgatgaggaggaggaagaggaggaggagggggaggaagaggacttggaaacg
gacgcgcagtgtgccaagagggactcactgctttccaccagctccgaggcctcccgggac
tccgccctgtccctcgcctcgtcccaggcctccgggtccaccctctcccgccagctgctg
acctccttcgtctcggggctctcggacggcgtggacagcggctacgtggaggacagcgag
gagagctcccccgagtggcccaggaggcccggcagccaggagcgccggggccaccgcagg
cccgggcagaagtttaacaggatctataaactcttcaagagcaccagccagctggtgctg
cggagggactctcggggcctggagggcagctcggacactgcgccgcccctgcggcgggcc
gggagcctctgcagccccctgggcagcccggcgctgcccccagcccgggcccagcgctcc
cgctccctgccccagcccaagctcagcacccagctgcccagctggctcctggcccccgcc
tcccgccaccagcgccgccgccccttcctgagtggggacgaagaccccaaggcctccaca
ctccgcgttgtggtcttcggctccgatcgcatttcagggaaggtagctcgggcgtacagc
aacctgcggcagctggagagcaatcgcccgctcctctctcggttcttcaagctacagttc
ttctatgtgcccgtgaagcggagccagggcaccagctccagcaccccagccactctgagc
cagacacccctactgcccccagactccccgaggcaccccagccctgcagagctgggcccg
gcccagtgggaggagagcaccaatgatatctcccactacctcggcatgctcgacccctgg
tatgaacgcaacgtgctgggcctcatgcacctgccccctgaagtcctgtgccagcagtcc
ctgaaggtggactcccgacccctggagggctcccccagccagctgcccatcctggctgac
atgctgctctactattgccgcttcgccgcaaggccggtgctgctgcaggtgtatcagaca
gagctgaccttcatcaccggggagaagacatcggagatcttcattcattccctggagctg
ggtcactctgctgccacacgagccatcaaggcttcaggtcccggcagcaagaggctgggc
attgatggggaccgggaggccgtcccgctaacactacagattatttacagcaagggggcc
atcagtgggcgaagtcgctggagcaacatggagaaggtctgcacctccatcaacctcaac
aaggcctgccggaagcaggaggagctagactccggcatagaggccctgactctaaacctg
acggaagtggtgaagaggcaaaaccccaaatccaagaaaggctttaaccagatcagcacc
tcgcagatcaaagtggacaaggtacagattatcggctccagaagctgcccctttgcagtg
tgtctggaccaagatgagaggaagatcctacagagtgtggtcaggtgtgaggtctcacct
tgctacaagccagagaagagcaacctctgcccccaaccccagaggtcaccccacccactg
gcccaggccccaccggacctctgctccctcctctgcctgcccatcatgactttcagcgga
gctctgccctag

DBGET integrated database retrieval system