KEGG   Miniopterus natalensis: 107530892
Entry
107530892         CDS       T05883                                 

Gene name
SLC12A5
Definition
(RefSeq) solute carrier family 12 member 5 isoform X1
  KO
K23967  solute carrier family 12 (potassium/chloride transporter), member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107530892 (SLC12A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107530892 (SLC12A5)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   107530892 (SLC12A5)
SSDB
Motif
Pfam: AA_permease SLC12 AA_permease_2
Other DBs
NCBI-GeneID: 107530892
NCBI-ProteinID: XP_016060306
LinkDB
Position
Unknown
AA seq 1139 aa
MSRRFTVTSLPPAGPAGTPDRESHGHPATDFRHLSGEDAKGDGNPKESSPFINSTDTEKG
KEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRM
GTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNG
VVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAE
DASGEASAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKS
AFEPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVTTQLWGLFCSSRFLNATCDEYFTQ
NNVTEIQGIPGAASGLIKENLWSSYLTKGVIVEKHGVPSVGLPDGTLVDMDHPYVFSDMT
SYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVILFGACI
EGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDG
IVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACA
VQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGA
EKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQDQNVVHPQLLSLTSQ
LKAGKGLTIVGSVLEGTFLDNHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHL
IQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAAHLALLVTKNVSMFPGN
PERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTT
FLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDES
RGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEG
EADPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLN
EVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS
NT seq 3420 nt   +upstreamnt  +downstreamnt
atgagccgcaggttcacagtcacctcgctgccccccgcggggcccgccgggacccccgac
cgagagtcccacgggcatccggccacagatttccgccacctctctggggaagacgccaaa
ggtgatggcaaccccaaggagagcagtcccttcatcaacagcaccgacacggagaagggg
aaggagtatgacggcaagaacatggctctgtttgaggaggagatggacaccagccccatg
gtgtcctccctgctcagtggcctggccaactacaccaacctgccccaaggaagtagggag
catgaagaggcagaaaacaatgagggtggaaaaaagaagccggtgcaggccccccgcatg
ggcaccttcatgggcgtgtacctaccgtgcctgcagaacatctttggtgtcattctcttc
ctgcgactcacttgggtggtgggcattgcgggcatcatggagtccttctgcatggtcttc
atctgctgctcctgcacgatgctcacggccatctccatgagtgcgattgcaaccaatggt
gttgtacccgctggcggctcctactacatgatttccaggtctctgggcccagagtttggg
ggcgccgtgggcctctgcttctacctgggcactacctttgctggggccatgtacatcctg
ggcaccatcgaaatcctgctggcttacctcttcccagctatggccatttttaaggcagaa
gatgccagtggggaggcctcagccatgttgaacaatatgcgtgtgtatggcacctgtgtg
ctcacctgtatggccaccgtggtatttgtgggtgtcaagtatgtcaacaagtttgccctt
gtcttcctgggttgtgtcatcctctccatcctggccatctatgctggggtcatcaaatct
gcctttgaaccgcccaacttcccgatctgcctcctggggaaccgcacactatctcgccat
ggctttgatgtctgtgccaagctggcttgggaaggaaatgagacggtgaccacacagctc
tggggccttttctgttcctctcgctttctcaatgccacctgtgatgagtacttcacccaa
aacaacgtcacggagatccagggcattcctggcgctgccagtggcctcattaaagagaac
ctctggagctcctacctgaccaagggggtgattgtggagaagcatggggtgccctcagtg
ggcctgcctgatggcacccttgtcgacatggatcatccctatgtattcagcgatatgacc
tcctacttcactctgctggttggcatctacttcccctcggtcacagggatcatggctggt
tctaatcgctccggggacctgcgggatgcccagaagtcaattcctactggcaccatcctg
gccattgccaccacctctgctgtctacatcagctccgttattctgtttggggcctgcatt
gagggggtcgtccttcgggacaagtttggtgaagctgtgaatggcaacctggtggtgggc
acactggcctggccatccccctgggtgatcgtcatcggatcctttttctccacctgtggg
gctgggctgcagagcctcacaggggccccacgcctgctgcaggccatctcccgggatggc
atagtgcccttcctgcaggtctttggccacggcaaagccaatggagagccaacatgggcc
ttgctcctgactgcctgcatctgcgagattggcatcctcattgcgtccctggatgaggtc
gcccccatcctctctatgttcttcctgatgtgttatatgttcgtgaacctggcctgtgca
gtacagacgctgctgaggacacccaactggaggccacgctttcgatattaccactggacg
ctctccttcctgggcatgagcctctgcctggccctcatgttcatctgctcctggtattac
gccctggtggccatgctcatcgccgggctcatctacaagtatatcgagtaccgtggggcg
gagaaggagtggggcgatgggatccgaggcctgtctctcagcgcggctcgctatgcactc
ttgcgcctggaggaagggcccccgcacaccaagaactggaggccacagctgctggtgctg
gtgcgtgtggaccaagaccagaatgtggtacacccacagctgctctcgttgacctcccag
ctgaaggcagggaaaggcctgaccattgtgggctctgtccttgaaggcacatttttggac
aatcatccccaggcccagcgggcagaagagtccatccggcgtctgatggaggcagagaaa
gtgaaaggcttctgccaggtagtgatttcctccaacctgcgtgatggcgtgtcccatcta
attcagtccgggggcctcggggggctgcagcacaacactgtgctcgtgggctggccccgc
aactggcggcagaaggaagatcatcagacgtggaggaacttcatcgagctggtccgggaa
accactgcagctcacctggccctgctggtcaccaagaacgtttccatgttcccggggaac
cccgagcgcttctccgagggcagcatcgacgtctggtggatcgtgcacgacgggggcatg
ctcatgctgctgcccttcctgctgcggcaccacaaggtctggcggaagtgcaagatgcgc
atcttcactgtggcccagatggatgacaacagcatccagatgaagaaggacctgaccaca
tttctgtaccatttacgtatcactgcagaggtcgaggtggtggagatgcatgagagcgac
atctcggcttacacctacgagaagactttggtgatggagcagcgttcccagatcctcaaa
cagatgcatttaaccaagaacgagcgggagcgggagatccagagtatcacggatgaatct
cgtggctcaatccggagaaagaatccagcaaacactcggctccgcctcaatgtcccagaa
gagacggctggtgacagtgaggagaagccagaagaggaggtgcagctgatccatgaccag
agtgctcccagctgccccagcagctcaccatctccaggggaggagcccgagggggagggg
gaggcagatcctgagaaagtgcatctcacctggaccaaggacaagtctgtggcagagaag
aataagggccccagtcctgtctcctccgagggcatcaaggacttcttcagcatgaagccg
gagtgggagaacttgaaccagtccaacgtgcggcgcatgcacacggccgtgcggctgaac
gaggtcattgtgaagaaatcccgggatgccaagcttgttttgctcaacatgcctgggcct
ccccgcaaccgcaacggtgacgaaaactacatggagttcctcgaggtcctcaccgagcac
ctggaccgggtgatgctggtccgcggcggcggccgcgaagtcatcaccatctactcctga

DBGET integrated database retrieval system