KEGG   Miniopterus natalensis: 107530984
Entry
107530984         CDS       T05883                                 

Gene name
MAP3K5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04071  Sphingolipid signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04530  Tight junction
mna04668  TNF signaling pathway
mna04714  Thermogenesis
mna04722  Neurotrophin signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107530984 (MAP3K5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107530984 (MAP3K5)
   04668 TNF signaling pathway
    107530984 (MAP3K5)
   04071 Sphingolipid signaling pathway
    107530984 (MAP3K5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107530984 (MAP3K5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107530984 (MAP3K5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107530984 (MAP3K5)
  09159 Environmental adaptation
   04714 Thermogenesis
    107530984 (MAP3K5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107530984 (MAP3K5)
   05012 Parkinson disease
    107530984 (MAP3K5)
   05014 Amyotrophic lateral sclerosis
    107530984 (MAP3K5)
   05016 Huntington disease
    107530984 (MAP3K5)
   05017 Spinocerebellar ataxia
    107530984 (MAP3K5)
   05022 Pathways of neurodegeneration - multiple diseases
    107530984 (MAP3K5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107530984 (MAP3K5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107530984 (MAP3K5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107530984 (MAP3K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107530984 (MAP3K5)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107530984 (MAP3K5)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE11 family
   107530984 (MAP3K5)
SSDB
Motif
Pfam: DUF4071 Pkinase PK_Tyr_Ser-Thr ASK_PH Pkinase_fungal Kinase-like FPP
Other DBs
NCBI-GeneID: 107530984
NCBI-ProteinID: XP_016060405
LinkDB
Position
Unknown
AA seq 1222 aa
MSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSNSLQSLKEIICQKNTMCTGNYTFVPY
MVTPHNKVYCCDCSLMKGLSELMQSNFELFLGPICLPLVDRFIQLLNVAQAGSSQYFRES
ILNDIRKARNLHTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQEYDSIVKLVE
TLEKLPTFDLASHHHVRFHYAFALNRRNLPGDRAKALDIMIPLVQSEGQVASDMYCLVGR
IYKDMFLDSNFMDTESRDNGAFWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKV
GVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHLRVIQASEKLFKLKTPAWYLKSIV
ETILIYKHFVKLTTEQPVAIQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKVYQPSYL
SINNEVEEKTISIWHVLPDDENGIHEWNFSASSIRGVSISKFEERCCFLYVLHNSDDFQI
YFCTELHCKKFFEMVNTITEEKGRGTEEGDCEGDSLEYDYEYDENGDRVVLGKGTYGIVY
AGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFME
QVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYS
GVLKISDFGTSKRLAGINPSTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMA
TGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRTCANDLLID
EFLKVSSKKKKAQPKLSALSPGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDAELKVDP
FSFKTRAKSCGEKDVKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLY
RILKEDQDKVVRNLMESLAQGPEEPKLKWEHITTLIISLREFVRSTDRKIIATTLSKLKL
ELDFDSHGISQVQVVLFSFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELR
PHFSLASESDTADQEDLDAEDDHEEQPPNRIVRRPHVIVEDAVATSGVSTLSSTVSHNSQ
NAHRSLNVQLGRMKIETNRLLEALVQKEKELQALLHYAIEEKDQEIKRLKFKSQPIDIPG
SPAHPSTSGTNTGDSELTDWLRENGADEDTISQFLAEDYSLEDVLYYVTRDDLKCLRLRG
GMLCTLWKAITDFRDKQRDKPT
NT seq 3669 nt   +upstreamnt  +downstreamnt
atgagtgacgccttccggcagccctccttgttttaccaccttggcgtgagagaaagtttc
agcatggccaacaacatcatcctctactgtgatactaactcaaactctctgcagtcattg
aaggaaatcatttgccagaagaatactatgtgcactgggaactacacgttcgttccttac
atggtaactccacacaacaaggtctactgctgtgactgcagcttgatgaagggcttgtca
gagctcatgcagtccaactttgagctgtttcttggacccatctgcttacctcttgtggat
cgtttcattcaacttctgaacgtggcacaagcaggttccagccagtatttccgggaatct
atactcaatgatatcaggaaagctcgtaatttacacactggtaaagaactggcagctgaa
ttggcaagaattcggcagcgagtagataatattgaagtcttgacagcagatattgtcata
aatctgttactttcctacagagatatccaggaatatgattctattgtgaagctggtagag
actttagaaaagctgccaacctttgatttggcctcccatcatcatgtgaggtttcattat
gcatttgcactgaataggaggaatctccctggagatagagcaaaagctcttgatattatg
attcccctggtgcaaagtgaagggcaagtagcttcagatatgtattgcctagttggtcga
atctacaaagacatgtttttggactctaatttcatggacactgaaagtagagataatgga
gctttttggttcaaaaaggcatttgaaagtgaacctacactacagtcaggaattaattat
gcagttcttcttctggcagctgggcaccagtttgaatcttcctttgagctccggaaagtt
ggagtgaagcttagtagccttctcggtaaaaagggaaacttggaaaaactccagagttac
tgggaagttggattttttctgggggccagtgttctggccaatgaccacttgagagtcatt
caggcatctgaaaagctttttaaactgaagacaccagcatggtacctcaagtctattgta
gagacaattttgatatataaacattttgtgaaactgactacagagcagcctgtggctatt
caggaactcgtggacttctggatggatttcctagtcgaggccacaaagacagatgttact
gtagttaggtttccagtattaatattagaaccaaccaaagtctatcaaccttcgtatttg
tctatcaacaatgaagttgaggaaaagacaatatctatttggcacgtgcttcctgatgac
gagaatggtatacatgagtggaacttcagtgcttcttccatcaggggagtgagcatttct
aaatttgaagaacgatgctgttttctttatgtgcttcataattctgatgatttccaaatc
tatttctgtacagaacttcattgtaaaaagttttttgaaatggtgaacaccattactgaa
gagaaggggagaggcacggaggaaggagactgtgaaggtgactccctggagtatgactat
gaatatgacgaaaatggtgacagagtcgttttaggaaaaggcacttacgggatagtctat
gcaggtcgagacctgagcaaccaagtcagaatcgctattaaggaaatcccagagagagac
agcagatactcccagcccctacatgaagaaatagcattgcataagcatctgaagcacaag
aatattgtccagtatctgggttctttcagtgagaatggtttcattaaaatcttcatggag
caggttccaggagggagtctttctgctctccttcgttccaaatggggcccactgaaagac
aatgaacaaacaatcgggttttatacaaagcaaatactcgaaggattgaaatacctccac
gacaatcagatcgttcaccgggatataaagggtgacaatgtgttgattaatacctatagt
ggtgttctcaagatctctgactttgggacatcaaagaggcttgctggcataaacccaagt
actgaaacttttacaggtacccttcagtatatggcaccagaaataatagataaaggacca
agaggttatgggaaagcagcagacatttggtctttgggctgcaccatcattgaaatggcc
acaggaaaaccacccttttatgagctgggagaacctcaagcagctatgttcaaggtggga
atgtttaaagtccaccctgagatcccagagtccatgtcagcagaggccaaggcattcata
ttgaagtgttttgaaccagaccctgacaagagaacctgtgctaacgacttgcttattgat
gagttcttaaaagtgtcaagcaaaaagaaaaaggcacagcctaagctttcagctctttca
cctggatcaaatgagtatctcaggagcatatccctgccagtgcccgtcctggtggaggac
acgagcagcagcagtgagtacggctcggtttctcccgacgcggagctcaaggtggacccc
ttctccttcaagacacgagccaaatcctgcggagaaaaagatgtgaaaggaatacggacc
ctctttctgggcattccagatgaaaatttcgaagatcatagcgctccaccttctcctgag
gaaaaagactccggattctttatgctgaggaaggacagtgaaagacgggccaccctttac
aggatcctgaaggaagaccaagacaaagttgtgagaaacttaatggaatctttggctcag
gggcctgaagaacctaaactaaaatgggagcacatcacaaccctcatcataagcctcaga
gaatttgtgagatccactgaccgaaaaatcatagccaccacactgtcaaagctgaagcta
gagctcgacttcgacagccacggcatcagccaagtccaggtggtgctcttcagttttcaa
gatgctgtcaataaagttcttcgaaatcacaacatcaagccacactggatgtttgcctta
gacagtatcatccgaaaggcagtgcagacagccattaccattctggttccagaactgagg
ccacattttagccttgcatctgagagtgataccgcagatcaagaagacttggatgcagaa
gatgaccatgaggaacagcctccaaatcggattgtccgaagacctcacgtcattgtcgaa
gatgcggtggctacctcaggagtgagcacgctcagttctactgtatctcacaattcccag
aatgctcaccgatcactgaatgtacagcttggaaggatgaaaatagaaactaatagatta
ctggaagcactggttcagaaagagaaagaattgcaagcactccttcattatgctattgaa
gaaaaagaccaagaaattaaacgcctgaagtttaagtcccaaccgatagatattcctgga
tcgcctgcgcatccctcaacttctggcacaaatactggagattctgaacttactgactgg
ctaagagaaaatggagccgatgaagacactataagtcagtttttggctgaagattattca
ctagaggatgttctatactatgttacacgtgatgacctaaaatgcctgagactaagggga
gggatgctgtgcacactgtggaaggccatcactgacttccgagacaaacagagggacaag
ccgacttga

DBGET integrated database retrieval system