KEGG   Miniopterus natalensis: 107531064
Entry
107531064         CDS       T05883                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04080  Neuroactive ligand-receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107531064
   04151 PI3K-Akt signaling pathway
    107531064
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107531064
   04060 Cytokine-cytokine receptor interaction
    107531064
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107531064
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107531064
Cytokines and growth factors [BR:mna04052]
 Cytokines
  CSF and other factors
   107531064
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 107531064
NCBI-ProteinID: XP_016060537
LinkDB
Position
Unknown
AA seq 217 aa
MAAGPWTSLLLAFALPCLPWPQEVGAFPAMSLSGLFANAVLRAQHLHQLAADTYKEFERT
YIPEGQRYSILNAQAAFCFSETIPAPTGKEEARQKSDVELLRFSLLLIQSWLGPLQALGR
AFPSGLLIGISSGVYEKLKDLEEGIQALMRELEDGSPPAGLIFTQTYDSFDTNLRSSSET
LLKNYGLLSCFKKDLHKVETYLRFTKCRRFMESSCVF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggcccttggacctccctgctcctggctttcgccctgccctgcctgccctgg
ccccaggaggtgggcgccttccccgccatgtccttgtctggcctgttcgccaacgctgtg
ctccgggcccagcacctgcaccagctggctgctgacacctacaaggagtttgagcgcacg
tacatcccggagggccagagatactcgatcctcaacgcccaggctgccttctgcttctcg
gagaccatcccggcccccacgggcaaggaggaggcccggcagaaatccgacgtggagctg
ctccgcttctcgctgctgctcatccagtcgtggctcgggcccctgcaggccctgggcagg
gccttccccagcggcctgctgataggcatctccagcggcgtctatgagaagctgaaggac
ctggaggagggcatccaagccctgatgcgggagctggaagatggcagccccccggctggg
ctgatcttcacgcaaacctacgacagctttgacaccaacctgcgtagcagcagtgagacc
ctgctcaagaactacgggctactctcctgcttcaagaaggacctgcacaaggttgagacg
tacctgcgcttcacgaagtgtcgccgcttcatggaaagcagctgtgtcttctag

DBGET integrated database retrieval system