KEGG   Miniopterus natalensis: 107531103
Entry
107531103         CDS       T05883                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04012  ErbB signaling pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04068  FoxO signaling pathway
mna04150  mTOR signaling pathway
mna04270  Vascular smooth muscle contraction
mna04510  Focal adhesion
mna04650  Natural killer cell mediated cytotoxicity
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04726  Serotonergic synapse
mna04730  Long-term depression
mna04810  Regulation of actin cytoskeleton
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05034  Alcoholism
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107531103 (BRAF)
   04012 ErbB signaling pathway
    107531103 (BRAF)
   04015 Rap1 signaling pathway
    107531103 (BRAF)
   04068 FoxO signaling pathway
    107531103 (BRAF)
   04024 cAMP signaling pathway
    107531103 (BRAF)
   04150 mTOR signaling pathway
    107531103 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107531103 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107531103 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107531103 (BRAF)
   04062 Chemokine signaling pathway
    107531103 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107531103 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    107531103 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    107531103 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107531103 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    107531103 (BRAF)
   04720 Long-term potentiation
    107531103 (BRAF)
   04730 Long-term depression
    107531103 (BRAF)
   04722 Neurotrophin signaling pathway
    107531103 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531103 (BRAF)
   05205 Proteoglycans in cancer
    107531103 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107531103 (BRAF)
   05212 Pancreatic cancer
    107531103 (BRAF)
   05225 Hepatocellular carcinoma
    107531103 (BRAF)
   05226 Gastric cancer
    107531103 (BRAF)
   05214 Glioma
    107531103 (BRAF)
   05216 Thyroid cancer
    107531103 (BRAF)
   05221 Acute myeloid leukemia
    107531103 (BRAF)
   05220 Chronic myeloid leukemia
    107531103 (BRAF)
   05218 Melanoma
    107531103 (BRAF)
   05211 Renal cell carcinoma
    107531103 (BRAF)
   05219 Bladder cancer
    107531103 (BRAF)
   05215 Prostate cancer
    107531103 (BRAF)
   05213 Endometrial cancer
    107531103 (BRAF)
   05224 Breast cancer
    107531103 (BRAF)
   05223 Non-small cell lung cancer
    107531103 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107531103 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    107531103 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    107531103 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107531103 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107531103 (BRAF)
   05160 Hepatitis C
    107531103 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107531103 (BRAF)
   01522 Endocrine resistance
    107531103 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107531103 (BRAF)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107531103 (BRAF)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107531103 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 107531103
NCBI-ProteinID: XP_016060578
LinkDB
Position
Unknown
AA seq 761 aa
MAALSGDGGTEQGQALFNGDMEPEAGAAASSSADPAIPEEVWNIKQMIKLTQEHIEALLD
KFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSSSS
SLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALM
MRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLA
FCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEAS
LAETALTSGSSPSAPPSDSFGPQMLTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSA
PNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRER
KSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLN
VTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIET
KFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSG
SHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQII
FMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR
SASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcgacggcggcacggagcagggccaggctctgttcaacggggac
atggagcccgaggccggcgccgcggcctcctcgtctgcggacccggccatccccgaggag
gtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaggcactattggac
aaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaatacacc
agcaagctagatgccctccaacaaagagaacaacagttattggaatccctggggaatgga
actgatttttctgtttctagctctgcatcaacggacaccgttacatcttcttcctcttct
agcctttcagtgctaccttcatctctttcagtttttcaaaatcccacagatgtgtcacgg
agcaaccctaagtcaccacaaaaacctattgttagagtcttcctgcccaacaaacagagg
acagtggtccctgcaaggtgtggagttacagtccgggacagtctaaagaaagccttgatg
atgagaggtctaatcccagaatgctgtgctgtttacagaattcaggatggagagaagaag
ccaattggttgggacactgatatttcttggcttactggagaggaattgcatgtagaagta
ttggagaatgttccacttacaacacacaactttgtacgaaaaacttttttcaccttagca
ttttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaaacatgtggttat
aaatttcaccagcgttgtagtacagaggtgccgctgatgtgtgttaattatgaccaactt
gatttgctgtttgtctccaagttttttgaacaccacccaataccacaggaggaggcctcc
ttagccgagactgcccttacgtctgggtcatccccttccgcacccccctccgattctttt
gggccccaaatgctcaccagtccgtctccttcaaaatccattccaattccacagcctttc
cgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccggtcctcatcagct
ccaaatgtgcatataaacacaatagaacctgtcaatattgatgacttgattagagaccaa
gggtttcgtagtgatggaggatcaactacaggcttgtctgccaccccccctgcctcatta
cctggctcacttactaatgtgaaagcattgcagaaatccccaggacctcagcgggaaagg
aaatcatcttcatcctcagaagacaggaatcgcatgaaaacacttggtagacgggattca
agtgatgattgggagattcctgatgggcagatcacagtgggacaaagaattggatctggg
tcatttgggacagtctacaagggaaagtggcatggtgatgtggcagtgaaaatgttgaat
gtgacagcacccacacctcagcagttacaggccttcaaaaatgaagtaggagtactcagg
aaaactcgacatgtgaatattctactcttcatgggctattcaacaaagccacagttggca
attgttacccagtggtgtgagggctccagcttatatcaccatctccacatcattgagacc
aagttcgagatgatcaaacttatagatattgcacggcagactgcacagggcatggattac
ttacacgccaagtcaatcatccacagagacctcaagagtaataatatctttcttcatgaa
gacctcacagtaaaaataggtgactttggcctagccacagtgaaatctcgatggagtggg
tcccatcagtttgaacagttgtctggatccatcttgtggatggcaccagaagtaatcaga
atgcaagataaaaacccatatagctttcaatcagatgtatatgcgtttgggatagttctg
tatgaattgatgactggacagttaccttattcaaacatcaacaacagggaccagataatt
tttatggtgggacgagggtatctatctccagatctcagtaaggtacgaagtaactgccca
aaagccatgaagagattaatggcagagtgcctaaaaaagaagagagatgagagaccactc
tttccccaaattctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgc
agtgcatcagaaccctccttgaatcgggctggcttccaaacagaggattttagtctgtat
gcttgtgcttctccaaaaacacccatccaggcagggggatatggagaatttgcagccttc
aagtag

DBGET integrated database retrieval system