KEGG   Miniopterus natalensis: 107531181
Entry
107531181         CDS       T05883                                 

Gene name
NFYC
Definition
(RefSeq) nuclear transcription factor Y subunit gamma isoform X1
  KO
K08066  nuclear transcription factor Y, gamma
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107531181 (NFYC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107531181 (NFYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107531181 (NFYC)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    107531181 (NFYC)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-X
Other DBs
NCBI-GeneID: 107531181
NCBI-ProteinID: XP_016060672
LinkDB
Position
Unknown
AA seq 439 aa
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNTGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQRNSV
QQARGSELTGEAEPREVKATGNATPCTSSPPTTHTPSHRAGASCVCCSQPQQSSTSPPPS
DALQWVVVEVSGAPNQLEAHRELHAPLPGVTSLSPLHPSQQLYQIQQVTMPAGQDLAQPM
FIQSANQPSDGQAPQVTGD
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtccacagaaggaggatttggtggtaccagcagcagtgatgcccagcaaagcctacag
tccttctggcctcgtgtcatggaagaaatccggaatttaacagtgaaagatttccgagta
caggaactcccactggctcgtattaagaagattatgaaactggatgaagatgtgaagatg
atcagtgcagaagcccctgtgctctttgccaaggcagcccagatttttatcacagagttg
acccttcgagcctggatccacacagaggacaacaagcgccggactctacagaggaatgat
atcgccatggcaattacaaaatttgatcagtttgactttctcatcgatattgttccaaga
gatgaactgaaacctccaaagcgtcaggaggaggtgcgccagtctgtgactcctgccgag
cctgtccagtactacttcacgctggctcagcagcccaccgccgtccaagtccaggggcag
cagcaaggccagcagaccaccagctccacaaccaccatccagcccgggcagatcatcatt
gcacagcctcagcagggccagaccacaccagtgaccatgcaggttggagaaggtcaacag
gtgcagattgtccaggcccagccacagggtcaagcccagcaggcccagagtggcactgga
cagaccatgcaagtgatgcagcagatcatcacaaacacaggagagatccagcagatcccg
gtgcagctgaacaccggccagctgcagtatattcgcttagcccagcctgtatcaggcacc
caagttgtgcagggacagatccagacgcttgccaccaatgctcaacagatcacacagaca
gaggtccagcaaggacaacagcagttcagccagttcacagatggacagaggaacagcgtg
cagcaagctcgaggctctgagctaacgggagaggcagagcccagagaagtgaaagccaca
ggaaatgcaactccctgcacctcttccccgcccactacacacacaccctcacaccgtgct
ggtgcctcctgtgtctgctgctcccaaccccagcagagctccacatcccctcctccctct
gacgccttgcagtgggtggtggttgaagtatctggggcccccaaccaactcgaggcccat
agggagctgcatgcccctctcccaggggtgacctcactctctcctctccacccctcgcag
cagctctaccagatccagcaagtcaccatgcctgccggccaggacctcgcccagcccatg
ttcatccagtcagctaaccagccctccgacgggcaggccccccaggtgaccggagactga

KEGG   Miniopterus natalensis: 107536891
Entry
107536891         CDS       T05883                                 

Gene name
NFYA
Definition
(RefSeq) nuclear transcription factor Y subunit alpha isoform X1
  KO
K08064  nuclear transcription factor Y, alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05017  Spinocerebellar ataxia
mna05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107536891 (NFYA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107536891 (NFYA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107536891 (NFYA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107536891 (NFYA)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    107536891 (NFYA)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
NCBI-GeneID: 107536891
NCBI-ProteinID: XP_016068246
LinkDB
Position
Unknown
AA seq 347 aa
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQSQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV
PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQTDEEAMTQIIRVS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagcagtatacagcgaacagcaatagttcaacagagcagattgttgtacaggccgga
cagattcagcaacagcagcagggtggtgtcactgctgtccagttgcagactgaggcccag
gtggcatcggcctcaggccagcaagtccagaccctccaggtagtccaggggcagccatta
atggtacaggtcagtgggggccagctgatcacatcaactggccaacccatcatggtccag
gctgtccctggtggacaaggccaaaccatcatgcaagtacctgtatctgggacacagggt
ttgcagcagatacagttggtgccacccggacagatccagatccagggtgggcaggccgtg
caggttcagggccagcagggccagacccagcagatcatcatccagcagccccagacagct
gtcaccgctggccagagccagacacaacagcagattgctgtccagggtcagcaagtggca
cagactgctgaagggcagaccatcgtttatcagccagttaatgcagatggcaccattctc
cagcaagttacagtccctgtttcaggcatgatcaccatcccagcagccagtttggcagga
gcacagattgttcagacaggagccaacaccaatacaaccagcagtggacaagggactgtc
actgtgacactaccagtggcaggcaatgtggtcaattcaggagggatggtcatgatggta
cctggtgctggctctgtgcctgctatccaaagaatccctctacctggggcagagatgctc
gaggaagagcctctctatgtgaatgccaaacagtaccaccgcatacttaagaggaggcaa
gcccgagccaaactagaggcagaagggaaaattccaaaggaaagaaggaaatacctgcat
gagtctcggcaccgtcatgccatggcacggaagcgtggtgaaggtggacggtttttctct
ccaaaggagaaggatagtcctcatatgcaggatccaaaccaaacagatgaagaagcaatg
acacagatcatccgagtgtcctaa

KEGG   Miniopterus natalensis: 107545156
Entry
107545156         CDS       T05883                                 

Gene name
NFYB
Definition
(RefSeq) nuclear transcription factor Y subunit beta
  KO
K08065  nuclear transcription Y subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05152  Tuberculosis
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107545156 (NFYB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545156 (NFYB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107545156 (NFYB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107545156 (NFYB)
Transcription factors [BR:mna03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    107545156 (NFYB)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TFIID-18kDa CENP-T_C TFIID_20kDa PAN_3
Other DBs
NCBI-GeneID: 107545156
NCBI-ProteinID: XP_016078713
LinkDB
Position
Unknown
AA seq 207 aa
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF
AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLGEELTEEAFTNQLPAGLIT
ADGQQQNVMVYTTSYQQISGVQQIQFS
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaccatggatggtgacagttctacaacagacgcttctcagctaggaatttctgcagac
tacattggaggaagtcactatgttatacagccgcatgatgatactgaggacagcatgaat
gatcacgaagacacaaatggttcaaaagaaagtttcagagaacaagatatataccttcca
attgcaaatgtggcgaggatcatgaaaaatgccatcccgcagacgggaaagattgcaaaa
gatgccaaagaatgtgttcaggaatgtgtgagtgagttcatcagctttataacatctgag
gccagcgaaagatgccatcaggagaaacggaagacaatcaatggggaagatattctcttt
gccatgtctaccttaggctttgacagttatgtagaacccctaaaattgtaccttcagaag
ttcagagaggcgatgaaaggagagaagggaattggtggagcggtgacagctacggatgga
ctaggtgaagagctgacagaggaggccttcactaaccagttaccagctggcttaataact
gcagatggtcaacagcaaaatgttatggtttatacaacatcatatcaacagatttctggt
gttcaacaaattcagttttcatga

DBGET integrated database retrieval system