KEGG   Miniopterus natalensis: 107531265
Entry
107531265         CDS       T05883                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04137  Mitophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04668  TNF signaling pathway
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04728  Dopaminergic synapse
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04918  Thyroid hormone synthesis
mna04922  Glucagon signaling pathway
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04932  Non-alcoholic fatty liver disease
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05203  Viral carcinogenesis
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107531265 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107531265 (ATF4)
   04668 TNF signaling pathway
    107531265 (ATF4)
   04022 cGMP-PKG signaling pathway
    107531265 (ATF4)
   04151 PI3K-Akt signaling pathway
    107531265 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107531265 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    107531265 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107531265 (ATF4)
   04922 Glucagon signaling pathway
    107531265 (ATF4)
   04912 GnRH signaling pathway
    107531265 (ATF4)
   04915 Estrogen signaling pathway
    107531265 (ATF4)
   04926 Relaxin signaling pathway
    107531265 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    107531265 (ATF4)
   04918 Thyroid hormone synthesis
    107531265 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    107531265 (ATF4)
   04925 Aldosterone synthesis and secretion
    107531265 (ATF4)
   04927 Cortisol synthesis and secretion
    107531265 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107531265 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    107531265 (ATF4)
   04728 Dopaminergic synapse
    107531265 (ATF4)
   04720 Long-term potentiation
    107531265 (ATF4)
   04722 Neurotrophin signaling pathway
    107531265 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    107531265 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107531265 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    107531265 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107531265 (ATF4)
   05012 Parkinson disease
    107531265 (ATF4)
   05014 Amyotrophic lateral sclerosis
    107531265 (ATF4)
   05020 Prion disease
    107531265 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    107531265 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    107531265 (ATF4)
   05031 Amphetamine addiction
    107531265 (ATF4)
   05034 Alcoholism
    107531265 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107531265 (ATF4)
   04934 Cushing syndrome
    107531265 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107531265 (ATF4)
   05161 Hepatitis B
    107531265 (ATF4)
   05163 Human cytomegalovirus infection
    107531265 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107531265 (ATF4)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    107531265 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 DUF3450 Baculo_F DUF4820 ZapB bZIP_Maf HALZ DUF724 Atg14 DUF2968
Other DBs
NCBI-GeneID: 107531265
NCBI-ProteinID: XP_016060785
LinkDB
Position
Unknown
AA seq 351 aa
MTEMSFLSSEVLVGGLMSPFDQSGLGAEESLGLLDDYLEVAKHFKSHGFSSDKAKAGSSE
WLAMDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDFDALLSFGDLETMPDELLATLDDTC
DLFDPLDQEINKEPPQTVNPIGHLPESLAKTDQVAPFTFLQPLPLSPGALSSTPDHSFSL
ELGSEVDISEGDRKSDSTAYVALTPQCIKEEDATSDDSGVCMSPESYLGSPQHSPCTSRA
SPHRNLLSQGTPCGSTCPKPYDPPIEKVVAAKVKGEKQDKRLKKMEQNKTAATRYRQKKR
AEQEALTDECKALERKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRAH
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgagcagcgaggtgttggtggggggcttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagacgactacctggaggtg
gccaagcacttcaaatctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctatggatgggttggtcagtgcctcagacaacggcaaggaggatgccttctcc
gggacagattggatggtggagaaaatggatctcaaggagtttgattttgatgccctgtta
agtttcggtgacctggaaaccatgcccgatgagcttttggccacgttggatgacacctgt
gatctctttgaccccctagaccaggagattaataaggagcccccccagacagtgaaccct
attggccatcttccagaaagtttagcaaaaactgaccaggttgcccccttcaccttcttg
cagcctcttcccctttccccaggggccctgtcctccactccggatcattcctttagttta
gagctgggcagtgaagttgatatctctgaaggagacaggaagtcagactccactgcttat
gttgccctaacccctcagtgcataaaggaggaagatgccacctcagatgacagtggcgtc
tgtatgagccctgagtcctatctgggctctccccagcatagtccctgtacctccagggcc
tctccacacaggaacctgttgtctcaaggtactccctgtggctctacttgccccaagccc
tatgaccctcccatagagaaggtagtagcagcaaaagtaaagggtgagaaacaggataaa
aggctgaaaaaaatggagcagaacaagacagcagccactaggtaccgccagaagaagcgg
gcagagcaggaggccctcactgatgagtgtaaagcgctagaaaggaaaaacgaagctctg
aaagagaaggcagactctttggccaaggagatacagtatctgaaagacctgatagaagag
gtccgcaaggccagggggaagaaaagggcccactag

DBGET integrated database retrieval system