KEGG   Miniopterus natalensis: 107531280
Entry
107531280         CDS       T05883                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04310  Wnt signaling pathway
mna04330  Notch signaling pathway
mna04350  TGF-beta signaling pathway
mna04520  Adherens junction
mna04630  JAK-STAT signaling pathway
mna04720  Long-term potentiation
mna04916  Melanogenesis
mna04919  Thyroid hormone signaling pathway
mna04922  Glucagon signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05016  Huntington disease
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05206  MicroRNAs in cancer
mna05211  Renal cell carcinoma
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107531280 (EP300)
   04330 Notch signaling pathway
    107531280 (EP300)
   04350 TGF-beta signaling pathway
    107531280 (EP300)
   04630 JAK-STAT signaling pathway
    107531280 (EP300)
   04066 HIF-1 signaling pathway
    107531280 (EP300)
   04068 FoxO signaling pathway
    107531280 (EP300)
   04024 cAMP signaling pathway
    107531280 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107531280 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107531280 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107531280 (EP300)
   04935 Growth hormone synthesis, secretion and action
    107531280 (EP300)
   04919 Thyroid hormone signaling pathway
    107531280 (EP300)
   04916 Melanogenesis
    107531280 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    107531280 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531280 (EP300)
   05206 MicroRNAs in cancer
    107531280 (EP300)
   05203 Viral carcinogenesis
    107531280 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107531280 (EP300)
   05215 Prostate cancer
    107531280 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107531280 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107531280 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107531280 (EP300)
   05161 Hepatitis B
    107531280 (EP300)
   05164 Influenza A
    107531280 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107531280 (EP300)
   05165 Human papillomavirus infection
    107531280 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107531280 (EP300)
   03036 Chromosome and associated proteins [BR:mna03036]
    107531280 (EP300)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107531280 (EP300)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     107531280 (EP300)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    107531280 (EP300)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    107531280 (EP300)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    107531280 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 107531280
NCBI-ProteinID: XP_016060807
LinkDB
Position
Unknown
AA seq 2411 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGIGGPGQGMASQAQQNSPGLGLINS
MVKSPIPNMGMGTSGPNQGPTPSATGMMNSPVNQPAMGMNTGMNAGMNPGMLTAGNGQGM
MPNQVMNGSIGAGRGRPNMQYPNPGMGNAGSLMTEPLQQGSPQMGGQAGLRGTQPLKMGM
MSNPNPYGSPYTQNSGQQMGASGLGLQMQTKSVLPNSLSPFAMDKKAVPGGGMPNMGQQQ
APQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNL
PHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQ
QSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQV
QGKNQQNQQSGQSPQGMRPMSNMNASPMGVNGGVGVQTSNLLSDSMLHSAINSQNPMMSE
NASVTSLGPMPTAAQPSSTGIRKPWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRME
NLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVP
VSMNTGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRMTPQPGLNQFGQMNMPQPPIG
PRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQAPFSTQGMNVTNMPLAPSG
GQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRTPTPHHTP
PGLGAQQPPATAVPAPVPTPPAMPPGPQSQALHPPPRQSPPPPPAQLAPQVQPPLPAAAA
DQPQPPLSQQSAPAPGATPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVSSQAVS
EKQPLQEVKVEAKMEVGQPEPADTQPADVPETKAEDCKVEPTETEERGTELKTETKEEED
QPSTSVTQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPD
YFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEV
FEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEI
QGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECAECGRKMHQICVLHHEVIWPT
GFFCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHA
SDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPP
NQRRVYISYLDSVHFFRPKCLRTAVYYEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIF
HCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDF
WPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNK
KKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRD
AFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCED
YDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQC
RNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLN
IKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTSQQPTTPQT
PQPQPPSQPQPTPPNSMPPYLPRTQAAGPVSQGKAPGQVTPPTPPQTAQPPLPGPPPAAV
EMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMNPMGPMGMNPPPMARGPSGHLEPGMGP
TGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTV
SQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQTLPGQPGM
PQGQPGLQPPAMPVQQGVHSNPAMQNMNPMQAGVQRASLPQQQPQQQLQPPMGGMSPQAQ
QMNMNHNTMPSQFRDILRRQQMMQQQQQGAGPGIGPGMANHNQFQQPQGVGYSPQQQQQQ
QQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQ
HMLPNQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQ
TSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLTSNPGMANLHGASATDLGLSTDNSDLN
SNLSQSTLDIH
NT seq 7236 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcctct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctatttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagccagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctctcagaattgctacggtctggtagttcccctaacctcaatatggggattggtggtcca
ggccaaggcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatccccaacatggggatgggcactagtggaccaaatcagggtccc
acaccttctgcaacaggtatgatgaacagtccagtaaatcaacctgccatgggaatgaat
acagggatgaatgctggcatgaatcctggaatgttgactgcaggcaacggacagggaatg
atgcctaatcaagtcatgaacggttcaattggagcaggccggggacgacctaatatgcag
tacccaaacccaggcatgggaaatgccggcagcttaatgactgagccactgcagcaaggc
tctccccaaatgggaggacaggcaggactgagaggcacccagcctcttaagatgggcatg
atgagcaacccgaatccgtacggctcgccgtacactcagaattctggacagcagatgggc
gccagtggtctcggtctccagatgcagacgaagtctgtgctgcccaatagcttatctcca
ttcgcaatggacaaaaaggcagttcctggtggaggaatgcccaacatgggccaacagcaa
gcccctcaggtccagcagccaggccttgtgacaccggtagcccaagggatgggttctggg
gcccacacagctgacccagagaagcgcaaactcatccagcagcagcttgttctccttctg
cacgctcacaagtgccagcgccgggagcaggctaacggggaggtgaggcagtgcaacctt
ccccactgccgcacaatgaagaacgtcctaaaccacatgacacactgccagtcaggcaag
tcttgccaagtggcacactgtgcgtcttctcgacaaatcatttcacactggaagaactgt
acaaggcatgattgtcctgtgtgtctcccccttaaaaatgctggggataagagaaatcag
cagtcaattctaactggagcgccagttggacttggaaatactagctctctaggggtcggt
caacagtctacacccagcctaagcactgttagtcagattgaccccagctctatagaaaga
gcctatgcagctcttggactaccctatcaagtaaatcagatgcccacacagccccaggta
caaggaaagaaccagcagaatcagcagtctgggcagtctccccaaggcatgcggcccatg
agcaacatgaatgctagtcctatgggagtaaatggaggtgtgggggttcaaacgtcgaat
cttctttctgactcgatgttgcattcagccataaattctcaaaacccaatgatgagtgaa
aatgccagtgtgacctccctgggtcctatgccaacagcagctcaaccatccagtactgga
attcggaaaccatggcatgaagatattactcaggatcttcgaaatcatcttgttcacaaa
cttgttcaagccatatttccaactccggatcctgctgctttaaaagacagacgtatggaa
aaccttgttgcatatgcccggaaagtggaaggggacatgtatgaatcagcaaataatcga
gcggaatactaccacctgctagctgagaagatctataaaatccagaaagaactagaagaa
aaacgaaggactaggctacaaaaacaaaacatgctgccaaatgctgcaggcatggtgcca
gtttccatgaacacaggtcctaacatggggcagccacaaccaggaatgacttctaatggc
ccccttcctgatccatctatgatccgtggcagcgtgccaaaccagatgatgcctcggatg
actccacaacccggtttaaatcaatttggccagatgaatatgccccagccccccattgga
ccacggcaaacctctcctcttcagcaccacggacagttagctcagcctggcactctcaac
ccacctatgggctatgggcctcgaatgcagcagccttccagccagagccagttccttccc
caggctcccttctcaacacagggaatgaatgtaacaaatatgcctttggctccatctgga
ggtcaagcaccagtgtctcaagcacaaatgtccagttcttcctgccctgtgaactctcct
ataatgcctccagggtctcaagggagccacattcactgtcctcctctccctcagccagct
ctgcatcagaactcaccctctcccgtacctagtcgaacccccacccctcaccacactccc
ccaggcctaggggctcagcagccaccagcaacagcagttccagcccctgttcctacacct
ccagccatgccacctgggccgcagtcccaggctctgcatccacccccaaggcagtcgccg
ccacctccgccagcgcagctcgctccccaagtgcagcctccacttcctgctgctgcagcg
gaccagccacagccgcctctctctcagcagagtgcgccggcgcccggcgccaccccgacc
gcgccgctgctgcccccgcagccggccactcccctttcccagccagctgtaagcattgag
gggcaggtgtcaaaccctccgtctactagtagcacagaagtgagttctcaggcggtctct
gagaagcagcctctacaggaggtgaaagtggaagccaaaatggaagtcggccagccagaa
ccagcagacactcagcccgcggatgttccagagactaaagcagaagactgtaaagtggaa
cctacagaaacagaggagaggggcactgaattaaaaactgaaacaaaagaggaggaagac
cagccgagtacgtcagttacccagtcgtctccagctccaggacagtcaaagaagaagatt
ttcaaaccagaagaattacgtcaggcgctgatgccaacactggaggcactttaccgacag
gatccagaatcccttccctttcgtcaacctgtggaccctcagcttctcggaatccctgat
tactttgatattgtgaagagccccatggatctttctacaatcaagaggaagttagacact
ggacagtatcaggagccctggcagtatgtggatgacatttggcttatgttcaacaatgcc
tggttatataatcggaaaacatcgcgagtatataaatactgctccaagctgtctgaggtc
tttgaacaagaaattgacccagtcatgcaaagccttggatattgttgtggcagaaagttg
gaattctctccacagacactctgttgctatggcaaacagttatgcacaatccctcgtgat
gccacgtactatagttaccagaacaggtatcatttctgtgagaagtgtttcaatgaaatc
caaggggagagcgtttctttgggggatgacccttcccagcctcaaactacaataaataaa
gaacagttttccaagaggaaaaatgacacactggatcctgaactgtttgttgaatgtgca
gagtgtggaagaaagatgcaccagatctgtgtccttcaccatgaggtcatctggccaact
gggtttttctgtgatggctgtttaaagaaaactgcacgaactaggaaagaaaataagctt
tctgctaaaaggttgccatctaccaggcttggcacctttctagagaatcgtgtgaatgac
tttctgaggcgacagaatcaccctgagtcaggagaagtcactgttcgtgtcgttcatgct
tctgacaaaactgtggaagtcaaaccaggcatgaaagcaaggtttgtggatagtggagag
atggccgaatcctttccctatcgaaccaaagccctctttgcctttgaagagattgatggt
gttgatttgtgcttctttggcatgcacgttcaggagtacggctcggactgccccccaccc
aaccagaggagagtatacatatcatacctcgatagtgttcatttcttccgtccgaaatgc
ttgaggactgcagtctattatgaaatcctaattggatatttagaatatgtcaagaaatta
ggttatacaacagggcatatttgggcatgtcccccaagtgagggagacgactatatcttc
cattgccatcctcctgaccagaagatacccaagcccaagcgactgcaggagtggtacaaa
aagatgcttgacaagtccgtgtctgagcgaattgtccatgactacaaggatatttttaaa
caagctactgaagatcgattaacaagtgcaaaggaattgccgtattttgaaggtgatttc
tggcccaatgttctggaagagagcattaaggaactggaacaggaggaggaagagaggaag
cgagaggaaaacaccagcaatgaaagcacagacgtgacaaagggagacagcaaaaatgct
aaaaagaagaataacaagaagacgagcaagaacaagagcagcttgagtaggggcaacaag
aagaagccaggcatgcccagcgtgtccaacgacctctcgcagaagctctacgccaccatg
gagaagcacaaagaggtcttctttgtcatccgtctcattgccggccctgccgccaactcc
ctgcctcccattgtggaccctgaccccctcatcccttgcgatctgatggatgggcgggac
gccttcctcaccctcgcgagggacaaacacctggagttctcatccctccggagagcccag
tggtccaccatgtgcatgctagtggagctgcacacccagagccaggaccgctttgtctac
acctgcaatgagtgcaagcaccacgtggagacgcgctggcactgtactgtgtgtgaggat
tatgacttgtgtatcacctgctataacactaaaaaccatgaccacaaaatggagaaacta
ggtctcggcttagatgatgagagcaacaaccagcaggctgcggccacccagagcccagga
gactctcgccgcctgagcattcagcgctgcatccagtctctggtccacgcctgccagtgc
cgaaatgccaactgttccctgccctcctgccagaagatgaaacgggtcgtgcagcacacc
aagggttgcaaacggaaaaccaatggagggtgccccatctgcaagcagctcattgccctc
tgttgctaccatgccaagcactgccaggagaacaagtgccctgtgccgttctgcctgaac
atcaagcaaaagctccggcagcagcagctgcagcaccggctccagcaggcccagatgctc
cgcaggagaatggccagcatgcagcggactggtgtggtaggacagcagcagggcctgccc
tccccaactcctgccacgccaaccacgccaaccagccagcagcccaccaccccacagacg
ccccagccccagcccccttctcagcctcagcccacccctcctaacagcatgccgccctac
ttgcccaggactcaagctgctggccctgtgtcccagggtaaagcaccaggccaggtgacc
cctccaaccccccctcagactgctcagcctccccttccggggcccccgcctgcagcagtg
gaaatggcaatgcagattcagagggcagctgagacacagcgccagatggcccatgtgcag
atttttcaaaggccaatccagcaccagatgccccagatgaacccaatgggccccatgggt
atgaacccacctcccatggccagaggtcccagtggacatttagagccagggatggggccc
actgggatgcagcaacagccaccatgggcccaaggaggattgcctcagccccaacaacta
cagtctgggatgccaaggccagccatgatgtcagtggcccagcatggtcagccattgaac
atggccccccaaccaggattgggccaggtcggtgtgagccctctcaaaccaggcactgtg
tctcaacaagccttacaaaaccttttgcggactctcaggtctcccagctctcccctccag
cagcaacaggtgcttagtatccttcacgccaacccccagttgttggctgcattcatcaag
cagcgggctgccaagtatgccaactctaatccacaaaccctccctgggcagcctggcatg
ccccagggccagccagggctgcagccccctgccatgcccgttcagcagggggtccactcc
aatccagccatgcagaacatgaatcccatgcaggcgggagtccagagggccagcctgccc
cagcagcaaccacagcagcagctccagccacccatgggagggatgagcccccaggctcag
cagatgaacatgaatcacaataccatgccttcacagttccgagacatcttgagacgacag
cagatgatgcagcagcagcagcagggagcagggccaggaattggccctgggatggccaac
cacaaccaattccagcagccccaaggagttggctactccccgcagcagcagcagcagcag
caacagcaacggatgcagcatcacatgcaacagatgcaacaagggaacatgggacagatg
ggccagctcccccaggccttgggagcagaggcaggagccagtctgcaggcctatcagcag
cgactccttcagcaacagatggggtcccctgctcagcccaaccccatgagcccccaacag
catatgctcccaaatcaggctcagtccccacatctacaaggccagcagatcccttctctc
tccaatcaagtgcgttctccccagcctgtcccttctccacggccacagtctcagcccccc
cactccagcccttccccaaggatgcaacctcagccttctccacaccacgtatccccacag
accagttctccacatccgggactggtagctgcccaggccaaccccatggaacaagggcat
tttgccagcccggaccagaattcgatgctttctcagctcactagcaatccaggcatggca
aacctccatggtgcaagcgccacggacctgggactcagcaccgataactcagacttgaat
tcaaacctctcgcagagtacactagacatacactag

KEGG   Miniopterus natalensis: 107535781
Entry
107535781         CDS       T05883                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04310  Wnt signaling pathway
mna04330  Notch signaling pathway
mna04350  TGF-beta signaling pathway
mna04520  Adherens junction
mna04630  JAK-STAT signaling pathway
mna04720  Long-term potentiation
mna04916  Melanogenesis
mna04919  Thyroid hormone signaling pathway
mna04922  Glucagon signaling pathway
mna04935  Growth hormone synthesis, secretion and action
mna05016  Huntington disease
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05206  MicroRNAs in cancer
mna05211  Renal cell carcinoma
mna05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107535781 (CREBBP)
   04330 Notch signaling pathway
    107535781 (CREBBP)
   04350 TGF-beta signaling pathway
    107535781 (CREBBP)
   04630 JAK-STAT signaling pathway
    107535781 (CREBBP)
   04066 HIF-1 signaling pathway
    107535781 (CREBBP)
   04068 FoxO signaling pathway
    107535781 (CREBBP)
   04024 cAMP signaling pathway
    107535781 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107535781 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107535781 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107535781 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    107535781 (CREBBP)
   04919 Thyroid hormone signaling pathway
    107535781 (CREBBP)
   04916 Melanogenesis
    107535781 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    107535781 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107535781 (CREBBP)
   05206 MicroRNAs in cancer
    107535781 (CREBBP)
   05203 Viral carcinogenesis
    107535781 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107535781 (CREBBP)
   05215 Prostate cancer
    107535781 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107535781 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107535781 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107535781 (CREBBP)
   05161 Hepatitis B
    107535781 (CREBBP)
   05164 Influenza A
    107535781 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107535781 (CREBBP)
   05165 Human papillomavirus infection
    107535781 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107535781 (CREBBP)
   03036 Chromosome and associated proteins [BR:mna03036]
    107535781 (CREBBP)
   03029 Mitochondrial biogenesis [BR:mna03029]
    107535781 (CREBBP)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     107535781 (CREBBP)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    107535781 (CREBBP)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    107535781 (CREBBP)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    107535781 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 107535781
NCBI-ProteinID: XP_016066835
LinkDB
Position
Unknown
AA seq 2325 aa
MANLGTMGKSPLNQGDSSAPSLPKQAASTSGPTPPASQPLNQQAQKQVGMVTSSPATSQT
GPGICMNANFNQTHPGLLNSNSGHSLLNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAM
QGATSSVLAETLTQVSPQISSHAGLNTAQAGGMTKMGMTGNTSPFGQPFSQTGGQPMGAP
GVNPQLPSKQNVVTSLPPFPADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKR
KLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCAS
SRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNASSLS
NPNPIDPSSMQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNALGNNPMNI
PAGGITADQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKG
WHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYY
HLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQSQPVRPPNGPMPLP
VNRMQVSQGMNSFNPMPLGNVQLPQAPMGPRAASPMNHSVPMNNMGSVPGMAISPSRMPQ
PPNMMGAHANNMMAQAPSQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQTGVSQGQVPGAA
LPNPLNMLGSQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPTAPVMTPPQPAAPTQPSTP
VSSSGQTPTPTPGSVPSASQAQSTPTVQAAAQVTPQPQTPVQPPSVATPQSSQQQPTPVH
AQPPGTPLSQAAASIENRVPTPSSVASAETNSQQPGPEIPMLEMKAEVKTEDIEPDASEP
KGEPGSAMMEEDLQGSSQVKEESETTEQKSEPMEVDEKKPEVKVEAKEEEENTANGAASQ
SASPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPM
DLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVM
QSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGD
DPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLK
KTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKP
GMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISY
LDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKI
PKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESI
KELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNV
SNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARD
KHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCY
NTKSHTHKMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLP
SCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQ
QIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPTQPQPSP
VSMSPASFSSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLY
RVNINNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQAPIPQQQPMP
GMPRPVMSMQAQPTVAGPRMPNVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSN
PQLMAAFIKQRTAKYVASQPGLQPQPSLQAQPGLQPQPGLHQQPSLQNLNAMQASGPRPG
VPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQ
GSAGMAAGMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPMQGNSMGQMAAQMGQLGQMGQP
GLGADNTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMAT
SLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQ
GHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 6978 nt   +upstreamnt  +downstreamnt
atggccaatctgggtaccatgggcaagagccctctgaaccagggagattcttcagccccc
agcctgcccaagcaggcagccagcacctctgggcccactccccctgcttcccaaccactg
aatcagcaagcacaaaagcaagtggggatggtaaccagcagccctgccacgtcgcagaca
ggacctgggatctgcatgaatgctaactttaaccagacccacccaggcctcctcaatagt
aactctggccatagtttattgaaccaggcccagcagggacaagcgcaagtaatgaatgga
tctctgggggctgctggcagaggaaggggagctggaatgccataccctgctccagccatg
cagggggccacaagcagtgtgctggctgagacgttaacacaggtttcgccacaaatttcc
agtcacgcaggactgaacacggcacaggcaggaggcatgaccaagatgggaatgactggt
aacacaagtccatttggacaaccctttagtcaaactggagggcagccaatgggagcccct
ggagtgaacccccagttacccagcaaacagaatgtggtcactagtttgcctccctttcct
gcagacatcaagaatgcttcagtcaccaacgtgccaaacatgtctcagatgcaaacatca
gtgggaattgtacccacacaagcaattgcaacgggccccactgcagatcctgaaaaacgc
aaactgatacagcagcagctggttctactgcttcacgctcataaatgtcagagacgagaa
caagcaaacggagaggttcgggcctgctctctcccacattgtcgaaccatgaaaaatgtt
ttgaatcacatgacacactgtcaggctgggaaagcctgtcaagttgcccattgtgcatct
tcacgacaaatcatctctcattggaagaactgcacacgacatgactgtcctgtttgcctc
cctttgaaaaatgccagtgacaagcgaaaccaacaaaccatcctgggatctccagctagt
ggaattcagaacacaattggttctgttggtacaggccagcagaatgcttcttctttaagt
aacccaaatcctatagaccccagctctatgcagcgagcttatgctgctcttggacttccc
tacctgaaccagccccagacacagctgcagcctcaggttcctggccagcaaccagcacag
cctcaaactcaccagcagatgaggactctcaacgccctgggaaataacccaatgaacatt
ccagcaggaggaataacagcagatcagcagccaccgaacttgatttcagaatcagctctt
ccaacttcccttggggccacaaacccactgatgaatgatggctccaactctggaaacatt
ggaaccctcagcactataccgacagcagcacctccttccagcactggtgttcggaaaggc
tggcatgaacatgtcacccaggacctgcggagccatctagtacataaactcgtgcaagcc
atcttcccaacacctgaccctgcagccctgaaggatcgccgcatggagaacctagtggcc
tacgctaagaaagtagaaggggacatgtatgagtctgccaacagccgggatgaatactat
cacttattagcagagaaaatctataagatacaaaaagaactagaagaaaaacggaggtca
cgtttacacaaacaaggcatattgggtaaccaaccagccttaccagcccctggggcacag
ccccctgggattccacagtcacaacctgtgagacctccaaatgggcccatgcccctgcca
gtgaatcgcatgcaggtttctcaagggatgaattcatttaacccgatgcccttggggaat
gtacagttaccacaggctcccatgggaccgcgcgcagcatcccccatgaaccattctgtc
ccaatgaacaacatgggctccgttccagggatggccatttctccttcccgaatgcctcag
cctccgaacatgatgggtgcacatgccaacaacatgatggcccaggcaccctcgcagaac
cagttcctgccgcagaaccagttcccttcgtccagcggggcaatgagtgtgaacagtgta
ggcatggggcagccagcggcccagacaggcgtgtcacaggggcaagtgcctggtgctgct
cttcctaatcctttgaacatgcttgggtcccagctgccttgcccaccagtgacacagtca
ccgttgcaccagacgccacctcctgcttccacagctgctggcatgccatctctccaacat
ccaacagcacctgtgatgactcctccccagccagcagctcccacccagccttcgactcct
gtgtcgtcttccgggcagactccaaccccgactcctggctcagtgcccagtgctagtcaa
gcccagagcacccctacggtccaggcagcagcccaggtgaccccgcagcctcagacccca
gttcagcccccatctgtggccactcctcagtcatcgcagcagcagccaacgcctgtgcat
gcccagcctcctggcactccgctttcccaggcagcagccagcattgagaacagggtaccc
actccatcctcagtggccagtgctgaaactaactcccagcagccaggacccgaaatacca
atgctggaaatgaaggctgaggtcaagactgaggacattgagccagatgccagtgaaccc
aaaggggagcctgggtctgcgatgatggaggaggatctacaaggatcttctcaagttaaa
gaagaatcagaaacaacagagcagaaatcagaaccgatggaagtggatgaaaagaaacca
gaagtaaaagtagaagctaaagaggaagaagagaacaccgctaatggcgctgcctcccag
tcagcatctccttcgcagccacgcaaaaaaatctttaagccggaggaattgcgccaagct
cttatgccaaccctagaagcactgtatcgacaggatccagagtccttaccttttcgccag
cctgtagatccccagctcctaggaattccagattactttgacattgtgaagaaccccatg
gacctttccaccatcaagcgaaagttggacacagggcagtaccaagaaccctggcagtac
gtggatgatgtctggctgatgttcaacaacgcctggctgtataatcgcaagacgtcccgg
gtctataagttttgcagtaaactggcagaggtgtttgaacaagaaattgaccctgttatg
cagtcccttggatattgctgtggacgcaagtatgagttttccccacagactttgtgctgc
tatgggaagcagctgtgtacaattcctcgtgatgcagcctactacagctatcagaatagg
tatcatttttgtgagaagtgtttcacagagatccagggggagaatgttaccctgggtgac
gacccttcacaaccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaacgat
accttagatcctgaaccttttgttgattgcaaggagtgtggccggaagatgcatcagatt
tgtgttttacactatgatatcatttggccatcaggttttgtgtgtgacaactgcttgaag
aaaactggcagaactcgaaaagaaaacaaatttagtgctaagagactgcagaccacgcga
ttgggaaaccacttagaagacagagtcaacaagttcttgcggcgacagaatcatcctgaa
gccggggaggtctttgttcgagtggtggccagctcagacaagactgtggaggtcaaacct
gggatgaagtcacggtttgtggactctggggaaatgtctgaatctttcccgtatcgaacc
aaagcactctttgcttttgaggaaattgatggagtggatgtgtgcttctttgggatgcat
gtccaagaatatggctctgattgcccccctccaaacacaaggcgtgtgtacatatcttat
ttggacagtattcatttcttccggccccgatgccttcgaacagccgtttaccatgagatc
cttattggatatttagaatatgtgaagaaattggggtatgtgacaggacacatttgggcc
tgtcctccaagtgaaggagatgactacatcttccattgccacccccctgatcagaaaatc
ccaaaaccgaagcgcctgcaggagtggtacaagaagatgctggacaaggcttttgcagag
cggatcatccatgactacaaggacatttttaaacaagcaactgaagacaggctcaccagt
gccaaggaactgccctattttgagggtgacttctggcccaatgtgttggaggagagcatt
aaggagctggaacaagaagaagaagagaggaagaaggaggaaagcactgcggccagtgag
actacagagggcagccagggtgacagcaagaatgctaagaaaaagaacaacaagaaaact
aacaagaataaaagcagtatcagcagggccaacaagaagaaacccagtatgcccaatgtg
tccaacgacttgtcccagaaactctacgccaccatggagaagcataaagaggtcttcttt
gtgattcacctccatgctggacctgtcatcaatacgctgccccctatcgttgaccccgac
cccctcctcagttgcgacctcatggatgggcgcgatgccttcctcaccctcgcaagggac
aagcactgggaattctcctccttgaggcggtccaagtggtccacactgtgcatgctggtg
gagttgcacacccagggccaggaccgctttgtctacacctgcaatgaatgcaagcaccac
gtggagacacgctggcactgcactgtgtgcgaggactacgacctttgcatcaactgctac
aacacaaagagccacacccacaagatggtgaagtgggggctgggcctggacgacgaaggc
ggcagccagggtgagccacagtccaagagccctcaggagtcacggcgcctgagcatccag
cgctgcatccagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccg
tcctgccagaagatgaagcgggttgtgcagcacaccaagggctgcaagcgcaagaccaat
ggaggctgcccagtgtgcaagcagctcattgccctttgctgctaccatgccaaacactgc
caagaaaacaaatgccccgtgcccttctgcctcaacatcaaacacaagcttcgccagcaa
cagatccagcaccgcctgcagcaagcgcagctcatgcgtcgacggatggccaccatgaac
acccgcaacgtgcctcagcagagtctgccttcccctacctcagcaccacctgggaccccc
acacagcagcccagcacaccccagacaccacagcccccaacccagccccagccctcacct
gtgagcatgtcaccagccagcttctccagtgtggcccgaactcagccccccaccacagtg
tccactgggaagcccaccaaccaggtgccagccccaccgcccccagcccagcccccaccc
gcagctgtggaggcagcccggcagattgaacgtgaggcccagcagcagcagcacctgtac
cgggtgaacatcaacaatggcatgcccccagggcgcacaggcatggtgacccctgtgagc
cagatggctcccgtgggcctgaatgtgccccgacccaaccaggtcagtgggcctgtcatg
cccaaccttccccccgggcaatggcagcaggcacccattccccagcaacagccgatgccg
ggcatgcccaggcccgtgatgtctatgcaggcccagccaactgtggccggaccacggatg
cccaatgtgcagccgcctcggagcatctcacctggcgccctacaggacctgctgcgaacc
ctgaagtctcccagctccccacagcagcagcagcaggtgctcaacatcctcaagtcaaac
cctcagctgatggcagctttcatcaaacagcgcacggccaagtatgtggccagtcagccc
ggcctgcagccccagcccagcctccaggcccagcctggcctgcagccccaacctggcctt
caccagcagcccagcctgcagaatctgaatgccatgcaagccagtgggccacggcctggt
gtccctccacagcagcaagcaatgggaggcctgaacccccagggccaggccctgaacatc
atgaacccagggcacaaccccaacatggcaagcatgaacccgcagtacagagagatgctg
cgaaggcagctgctgcagcagcagcagcagcagcagcaacagcaacagcaacaacagcag
ggcagtgctggcatggccgcaggcatggcaggacacggccagttccagcagcctcaagga
cctggaggctatcccccagccatgcagcagcagcggatgcagcagcacctgcccatgcag
ggcaactccatgggccagatggcagctcagatgggacagctcggccagatggggcagccc
gggctgggtgcagacaacacccccaacatccagcaagctctacagcagcggattctgcag
cagcagcagatgaagcagcagattgggtccccaggccagccaaaccccatgagcccccag
cagcacatgctctcaggacagccacaggcctcgcacctccctggccagcagatggccaca
tcccttagtagccaggtgcgatctcctgcccctgtccagtctccacgaccccagtcccag
cctccacattccagcccatcaccacggatacagccccagccttcaccacaccacgtctca
ccccagactggttctccccacccaggactcgcagtcaccatggccagctccatagatcag
ggacacttggggaaccccgaacagagtgcaatgctaccacagctgaatacccccaacagg
agtgctttgtccagtgagctgtccctggtcggcgacaccacaggagacaccctagaaaag
tttgtggagggtttgtag

DBGET integrated database retrieval system