KEGG   Miniopterus natalensis: 107531399
Entry
107531399         CDS       T05883                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein isoform X1
  KO
K06618  retinoblastoma-associated protein
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04110  Cell cycle
mna04218  Cellular senescence
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05212  Pancreatic cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107531399 (RB1)
   04218 Cellular senescence
    107531399 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531399 (RB1)
   05203 Viral carcinogenesis
    107531399 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107531399 (RB1)
   05225 Hepatocellular carcinoma
    107531399 (RB1)
   05226 Gastric cancer
    107531399 (RB1)
   05214 Glioma
    107531399 (RB1)
   05220 Chronic myeloid leukemia
    107531399 (RB1)
   05218 Melanoma
    107531399 (RB1)
   05219 Bladder cancer
    107531399 (RB1)
   05215 Prostate cancer
    107531399 (RB1)
   05224 Breast cancer
    107531399 (RB1)
   05222 Small cell lung cancer
    107531399 (RB1)
   05223 Non-small cell lung cancer
    107531399 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107531399 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107531399 (RB1)
   05161 Hepatitis B
    107531399 (RB1)
   05160 Hepatitis C
    107531399 (RB1)
   05163 Human cytomegalovirus infection
    107531399 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107531399 (RB1)
   05169 Epstein-Barr virus infection
    107531399 (RB1)
   05165 Human papillomavirus infection
    107531399 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107531399 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107531399 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107531399 (RB1)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107531399 (RB1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    107531399 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Other DBs
NCBI-GeneID: 107531399
NCBI-ProteinID: XP_016060928
LinkDB
Position
Unknown
AA seq 894 aa
MSRFLLAGYHTRLEFEETEEPDFTALCEKLKIPDHVRERAWLTWEKVSSADGVLESYIQK
KKELWGICIFIAAVDLDEMPFTFTELQKNIETSVYKFFDLLKEIDTSTKVDNAMSRLLKK
YHVLCALYSKLERTCELIYLTQPSSLISTEINSVLVLKVSWITFLLAKGEVLQMEDDLVI
SFQLMLCVLDYFIKLSPPALLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRII
EVLCKEHECNIDEVKNVYFKNFIPFMNSLGIVASNGLPEVESLSKQYEEIYLKNKDLDAR
LFLDHDKTLQTDPIDSFEMQRTPRKSNPDEELNMILPQTPVRTVMNTIQQLMMILNSASD
QPSENLISYFNNCTVNPMESILKRVKDIGYIFKEKFAKAVGQGCIEIGSQRYKLGVRLYY
RVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDTGTDLSF
PWILNVLNLKAFDFYKVIESFIKAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIK
QAKDREGPADHLEPACTLNLPLQNNHTAADMYLSPVRSPKKKGSTSRVNSTANAEAQATS
AFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYEL
MRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIV
FYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYK
ISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRMLKRSAEGSNPPKPLKK
LRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDISNREAK
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgtcaaggttcctacttgctggctatcataccaggcttgagtttgaagaaaccgaagaa
cctgattttactgcattatgtgagaaattaaagataccagatcatgtcagagaaagagct
tggttaacttgggagaaagtttcatctgcagatggagtattggaaagttatattcagaag
aaaaaggaactatggggcatctgtatctttattgcagcagttgacctagatgagatgcca
tttacttttactgagctacagaaaaacatagaaaccagtgtctataaattttttgattta
ctaaaagaaattgataccagtaccaaagttgataatgctatgtcaagactattgaagaag
tatcatgtattgtgtgcgctctacagcaaattagaaaggacatgtgaacttatatatttg
acacagcccagcagtttgatatcgactgaaataaattctgtgttggtgctaaaagtttct
tggatcacatttttactagctaaaggggaagtattacaaatggaagatgacctggtgatc
tcatttcagttaatgctatgtgtccttgactattttatcaaactctcacctcctgcattg
ctcaaagaaccatataaaacagctgtaatacctattaatggttcacctcgaacaccaagg
cgaggtcagaacaggagtgcacggatagcaaaacaactagaaaatgatacaagaattatt
gaagttctctgtaaagaacatgaatgtaatatagatgaggtgaaaaacgtttatttcaaa
aattttataccttttatgaattctcttggaattgtagcttcaaatggacttccagaggtg
gaaagtctctctaaacaatatgaagaaatttaccttaaaaacaaagatctagatgcaaga
ttatttctagatcatgataaaactctacagactgatccaatagacagttttgaaatgcag
agaacaccacgaaaaagtaaccctgatgaagagttgaatatgattcttccccaaactcca
gttaggactgttatgaatactatccaacaattaatgatgatcttaaattcagcaagtgat
caaccatcagaaaatctgatttcctattttaataactgcacagtgaatccaatggaaagt
atcctgaaaagagtaaaggatattggatacatctttaaagagaaatttgctaaagctgtg
ggacaaggatgtatagaaattggatcacagcgatacaaacttggagttcgattatattac
cgagtaatggaatccatgcttaaatcagaagaagaacgattatccattcaaaattttagc
aaactcctgaatgacaacatctttcatatgtctttgttggcatgtgctcttgaggttgta
atggctacatatagcagaagtacatctcagaatcttgatactggaacagatttgtccttc
ccatggattctgaatgtacttaatttaaaagcttttgatttttacaaagtgattgaaagt
tttatcaaagcagaagccaacttgaccagagaaatgataaaacatttagaacgatgtgaa
catcgaatcatggaatcccttgcatggctctcagattcacctttatttgatcttattaaa
caagcgaaggaccgagaaggaccagctgatcaccttgaacctgcttgtactctcaacctt
cctctccagaataatcacactgcagcagatatgtatctttctcctgtaagatccccaaag
aaaaaagggtcaacttcacgtgtaaattctactgcaaatgcagaggcacaagcaacctca
gccttccagactcagaagccattgaaatctacctccctctcactcttttacaaaaaagtg
taccgactagcatatcttcgactaaatactctgtgtgcacgtcttctgtctgaccaccca
gaactagaacacatcatctggacccttttccagcacacactgcaaaatgagtatgaactc
atgagagacaggcatttggaccagatcatgatgtgttccatgtatggcatatgcaaagtg
aagaatatagatctaaaattcaaaatcattgtcacagcttacaaggatcttcctcatgct
gttcaggagacatttaaacgggttttgataagagaagaggagtatgattctattatagtg
ttctataactcggtcttcatgcagagactgaagacaaatattttgcagtatgcttccacc
aggccccctaccttgtcaccaatacctcacattcctcgaagtccttacaagttttctagt
tcacctttacggattccgggagggaacatctatatatcacccctgaagaatccatataaa
atttcagaaggtctgccaacgccaacaaaaatgactccaagatcaagaatcttagtatcc
attggtgaatcatttgggacttctgagaagttccagaaaataaatcagatggtatgtaac
agtgaccgtatgctcaaaagaagtgccgaaggaagcaaccctcctaaaccattgaagaaa
ctacgcttcgatattgaaggatcagatgaagctgatggaagtaaacatctcccaggggag
tccaaatttcaacagaaactggcagaaatgacatctactcgaacacgaatgcaaaagcag
aaaatgaatgatagcatggatatctcaaacagggaagcaaagtga

DBGET integrated database retrieval system