KEGG   Miniopterus natalensis: 107531500
Entry
107531500         CDS       T05883                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04390  Hippo signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05200  Pathways in cancer
mna05218  Melanoma
mna05224  Breast cancer
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107531500 (FGF1)
   04014 Ras signaling pathway
    107531500 (FGF1)
   04015 Rap1 signaling pathway
    107531500 (FGF1)
   04390 Hippo signaling pathway
    107531500 (FGF1)
   04151 PI3K-Akt signaling pathway
    107531500 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107531500 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531500 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    107531500 (FGF1)
   05218 Melanoma
    107531500 (FGF1)
   05224 Breast cancer
    107531500 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107531500 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:mna00536]
    107531500 (FGF1)
Cytokines and growth factors [BR:mna04052]
 Growth factors
  Growth factors (RTK binding)
   107531500 (FGF1)
Glycosaminoglycan binding proteins [BR:mna00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107531500 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107531500
NCBI-ProteinID: XP_016061039
LinkDB
Position
Unknown
AA seq 155 aa
MAEGDVTTFTALTEKFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDKSDQHIQLQ
LSAESVGEVYIKSTESGQYLAMDSDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcagaaggggacgtcaccacgttcacggccctgaccgagaagtttaatctgcctctg
ggtaattacaagaagcccaaacttctctactgcagcaatgggggccacttcctgaggatc
ctcccagatggcacagtggatgggacaagggacaagagcgaccagcacattcagctgcag
ctcagcgcggaaagcgtgggggaggtgtatataaagagcaccgagagtggccagtacttg
gccatggactccgacgggcttttgtacggctcgcaaacaccaaatgaggagtgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcagaaaag
aattggttcgttgggctcaagaaaaatggaagctgcaagcgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcctctgattag

DBGET integrated database retrieval system