KEGG   Miniopterus natalensis: 107531508
Entry
107531508         CDS       T05883                                 

Gene name
ARAP3
Definition
(RefSeq) arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3
  KO
K12490  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107531508 (ARAP3)
   04024 cAMP signaling pathway
    107531508 (ARAP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107531508 (ARAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107531508 (ARAP3)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107531508 (ARAP3)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    107531508 (ARAP3)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    107531508 (ARAP3)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   107531508 (ARAP3)
SSDB
Motif
Pfam: RhoGAP PH ArfGap RA SAM_2 SAM_1 PH_8 PH_3 PH_6 PH_11 PH_2
Other DBs
NCBI-GeneID: 107531508
NCBI-ProteinID: XP_016061057
LinkDB
Position
Unknown
AA seq 1536 aa
MAAPQDLDIAVWLATVHLEQYADTFRKHGLATAGAAQGLGHEELKQLGISATGHRKRILR
LLQTGTAEGSLDPQLDSAMEPLPSPAPQAQPPKPVPKPRTVFGGLSGSTITQRPGMSPAL
LRPEVPRSPESSPRSLPLPTSFSEQPSALNAVEMMPNAIYFGLDLRGRAQIAPDRAADSS
QTAAPTPALRPTTGTVHIMDPGCLYYGVQPVGVSGAPNRREGRAEHRLSRQDLETREDAG
YASLELPGDPTFSLPTMDTETSDDLISPYASFSSIADRPTPLLSGWLDKLSPQGNYVFQR
RFVQFNGRSLMYFGNDKDPFPKGVIPLSAIEMTRSSKDNKFQVITSQRVFVFRTESETQR
DTWCSTLQSCLKEQRLLGHLRSPQQPRPLRTGMLELRGHKAKVFAALSPGELALYKSEQA
FSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQEAVSETLS
DYEVAEKIWSNRANLHCADCGASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLD
TSVWSNEIVQLFIVLGNDRANRFWAGALPPGERLHPDTPPGPRGEFISQKYRLGLFRKPH
PQYPDHSQLLQALCAAVTGPNLLKNMTQLLCVETSEGEEPWSPLALDGSFPGLLPSDSSL
GVYNEVVVPATYSSFLYCGPISNKAGPPPPRKGRDAPSRLWCVLGAALEMFVSESSPEPL
SLIQPQDVVCLGVSPPPTDSGDLDRFPFSFELILMGGRIQHFGTDGADSLEAWVSAVGKW
FSPLSCHQLLGPGLVRLGRLWLRSPSYTALAPGHWLSGFGLLRGDHLFLCPAPGPGPAVP
EDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFSAWNTAIGGAAGGG
GTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVK
LRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKEVIGFLPR
VNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRILQELIDGYV
SVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIIEVYIEQQLPDNCVTLKVSPTLTAE
ELTNQVLEMRGTAAGTDLWVTFEILEHGELERPLHPKEKVLEQALQWCQLPEPCSASLLL
RKVSLAQASCLFTGVQRESPKVGLLRCRGEPPRLLGNRFQERFFLLRGCSLLLHKEKKSS
KPEREWSLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSILKAQY
DDQQPVVLRRRSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPM
KSSQGSVEEQEELEEPVYEEPVYEEVGAFPELTKDTLTSFSTMRGQTAKSESPPASQRSS
DQPLLSKTGREERPPEPPPGPPSKNSSQAYASLEEQLLQELSSLILRKGETTLGLGSPSE
PSSPQPPSPSSHLTQTPGFPTPPPCTSSLPSSQPLT
NT seq 4611 nt   +upstreamnt  +downstreamnt
atggctgcccctcaggacctggacatcgctgtgtggctggccacggtgcacctggagcag
tatgcagacacgttccggaagcatggcctggctacagcgggtgcagcccagggcctgggc
cacgaggagctgaagcagctgggcatcagcgccacagggcaccggaaacgcatcttgcgc
ctgctgcagacgggcactgcagagggctccctggatccccaattggatagtgccatggag
ccattacccagcccagccccccaagcccagccccccaagcctgtgcctaagcccaggaca
gtatttggtgggctcagtggctccactatcacccagaggcctgggatgagcccagccctc
ttgagaccagaagtgcccaggagcccagagtccagcccaaggtcccttcctctccccacc
tcattctctgagcagccttcagccttgaatgccgtggagatgatgcccaatgccatctac
tttggcctggatttaagaggcagggcacagatagctcctgacagggctgcagacagctcc
cagacagctgccccaactcctgccctcaggcccaccacaggcacagtgcacatcatggac
cctggttgcctgtactatggtgtccagcctgtgggggtctcaggggcgcccaacagaaga
gaaggcagagctgagcacaggctcagcaggcaggatctggagacacgggaggacgctggc
tatgccagccttgagttgcctggggatcccaccttctcactgcccaccatggacacagag
accagtgatgacctcatttcgccctatgccagcttctcctccatcgcagaccgcccaacg
cccctgctcagtggctggctagacaagctctcccctcagggaaactacgtctttcagagg
cgctttgtgcagttcaatgggaggagtctgatgtactttggcaatgacaaggaccccttc
cccaagggtgtgatccctctgtccgccattgagatgacccgcagcagcaaggacaacaag
ttccaggtcatcaccagccagagggtgtttgtgttccgcacggagagcgagactcagcgg
gacacttggtgctccacattgcaatcctgcctgaaggagcagcgtctcctgggccacctg
aggagcccccagcagccccgacctctccgcacaggcatgctggagctgcgtggacacaag
gccaaagtgtttgcagccttgagccctggagagttggcgctgtacaagagtgagcaggcc
ttctccctgggcatcgggatctgcttcattgaactgcaagggtgcagtgtccgggagacc
aagagtcgcagcttcgacctgctcacaccccatcgctgcttcagcttcacagccgagtct
gggggtgctcggcagagctgggcggccgctctacaggaagcagtaagcgagaccctgtct
gactacgaggtggctgagaagatctggtctaatcgggcaaacctgcactgtgcggactgt
ggggcctcccgcccagactgggctgctgtcaacctgggagtggtcatctgcaagcagtgt
gccggtcagcaccgggctctgggttccgggatctccaaggtgcagagtctgaagctagac
acaagtgtctggagtaatgagatagtgcagttgttcattgtcttgggaaatgatcgagcc
aaccgcttctgggcaggggccctgcccccaggcgagaggctgcatccagatacaccccca
ggccctaggggagagttcatctcccagaagtaccggctgggtctcttccggaagccccac
cctcagtatccagatcacagccagcttctccaggcactgtgtgcagctgtgacaggaccc
aacctgctgaagaacatgacccagcttctctgtgttgaaacctctgagggtgaggagccg
tggtctcccttggccctcgatggcagcttccctggtctcctgccctcagactcctccctt
ggcgtgtacaatgaggtggtggtgcctgccacttacagcagcttcctgtactgtggtccc
atcagcaacaaagccggacccccaccccctcgcaagggccgggatgctccttcccggctg
tggtgtgtgctaggagcggctctggagatgtttgtgtcagaaagcagccccgaacccctc
agcctcattcagccccaggatgttgtatgtttgggtgtgagccctccacctactgactca
ggtgaccttgacaggttccccttttcctttgagctcatcctcatggggggcaggatccag
cattttggcactgatggagctgacagtctggaggcctgggtcagcgctgtgggcaagtgg
ttctccccgctgagctgtcaccagctgctgggccctgggctggtgcggctgggccgcctg
tggctgcggtccccctcctatacagccctggctcccggccactggctgtcagggtttgga
cttcttcgtggtgaccacctcttcctgtgtccagcaccgggccctggccctgcagtccct
gaggacatggtacatcttcggcggctacaggagatcagtgtagtctcggcagctgacacc
ccagacaagaaggagcatttggttctggtggagacaggaaggaccctgtatctgcaggga
gagggccggctggacttctcagcatggaacacagccattgggggagcagccggtgggggt
ggcacagggctgcaggagcagcagatgagtagaggtgacatccccatcatcgtggatgcc
tgcatcagttttgtcacccagcatgggctccggctggagggcgtgtaccggaaagggggc
gcgcgtgcccgcagcctgcggctcctggctgagtttcggcgggatgcccggtcggtgaag
ctccgaccaggggagcacttcgtggaggatgtcactgacacactcaaacgcttctttcga
gagctcgatgaccccgtgacctctgcacgattgctgcctcgctggagggaggctgccgag
ctgccccagaagaatcagcgcctggagaaatacaaagaagtgattggcttcttgccaagg
gtcaaccgccgcacactggccaccctcattgggcatctctatcgggtgcagaagtgtgca
gctctaaaccagatgtgcacacggaacctggccctgctgtttgcacccagtgtgttccag
acggatgggcgtggggaacacgaggtgcggatactgcaggaactcatcgacggctatgtc
tctgtctttgatatcgactctgaccaggtagctcagattgacttggaggtcagtctcatc
accacctggaaggatgtgcagctgtcccaggctggagacctcattatagaggtttatata
gaacaacagctcccagacaactgtgtcaccctgaaggtatccccaacactgactgcggag
gagctgactaaccaggtactggagatgcgggggacagcagctgggactgacttgtgggtg
acatttgagattcttgagcacggggagcttgagcggccactgcatcccaaggaaaaggtc
ctggagcaggccttacaatggtgccagctcccagagccctgctcggcctccttgctcttg
agaaaagtctccctggcccaggccagctgcctctttacaggtgtccagcgggagagccca
aaggtggggctcttgcggtgtcgaggggaaccgccccgcttgctgggaaaccgcttccag
gagaggttctttctgcttcgtggttgctccctactgctgcacaaagagaaaaagagctct
aaaccagaacgggagtggtctctggaaggtgccaaggtctacctggggatccgcaagaag
ttaaagcctccaacgccgtggggcttcacattgatactggagaagatgcacctctacctg
tcctgcactgatgaggatgagatgtgggactggaccaccagcatcctcaaagcccagtac
gatgaccagcagccagtggtcttacgacgccgttcctcctctgaccttgcccgtcagaag
ttcggcaccatgcctttgctacccatccgtggggatgacagcggggccactctcctctct
gccaatcagaccctgaggcgacttcacaatcggaggaccctgtccatgttctttccaatg
aagtcatcccaggggtctgtggaggagcaagaggaactggaggagcctgtgtatgaggag
ccagtgtacgaggaagtgggggccttcccagagctgaccaaagacaccctcacctccttc
tccaccatgagggggcagacagccaagtcagagagcccccccgccagccagaggtcctcc
gatcagccccttctctccaagacaggccgggaggagaggccaccagagccccctccaggt
cccccttcaaagaacagctcccaggcatatgcatccttggaggagcagctgctccaggag
ctcagcagcctcatcctgaggaagggagaaaccaccctaggcctgggcagcccctccgag
ccctccagcccccagcccccaagccccagcagccacctgacacagacacctggcttcccc
accccacctccctgcacttccagtctaccctccagccagcccctcacatga

DBGET integrated database retrieval system