KEGG   Miniopterus natalensis: 107531532
Entry
107531532         CDS       T05883                                 

Gene name
NPPA
Definition
(RefSeq) natriuretic peptides A
  KO
K12334  natriuretic peptide A
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04066  HIF-1 signaling pathway
mna04270  Vascular smooth muscle contraction
mna04714  Thermogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    107531532 (NPPA)
   04024 cAMP signaling pathway
    107531532 (NPPA)
   04022 cGMP-PKG signaling pathway
    107531532 (NPPA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107531532 (NPPA)
   04921 Oxytocin signaling pathway
    107531532 (NPPA)
   04924 Renin secretion
    107531532 (NPPA)
   04925 Aldosterone synthesis and secretion
    107531532 (NPPA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107531532 (NPPA)
  09159 Environmental adaptation
   04714 Thermogenesis
    107531532 (NPPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    107531532 (NPPA)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 107531532
NCBI-ProteinID: XP_016061118
LinkDB
Position
Unknown
AA seq 153 aa
MGSFPTITAGLFFFLAVQLPGQARANPVYSSVSNADLMDFKNLLDRLEDKVPLEEEVLPP
QGLSEQNEEAGAALSSLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKNKLRALLA
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggctccttccccaccatcaccgccggcctcttcttcttcttggccgtgcagctcccg
ggccaggcccgcgccaaccccgtgtacagctctgtgtccaacgccgacctgatggatttc
aagaatttgctggaccgtttggaggacaaggtgcctttagaagaggaggtcctgccccca
caaggactgagtgagcagaatgaagaggctggggccgctctcagctccctccctgaggtg
cccccctggaccggggaggtcagcccagcccagagagatgggggtgcccttgggcggggc
ccctgggactcctccgacagatcggccctcctgaaaaacaagctgagggcgctgctcgcc
gccccccggagcctgcggaggtccagctgcttcgggggcaggatggacaggatcggagcc
cagagcggcctgggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system