KEGG   Miniopterus natalensis: 107531602
Entry
107531602         CDS       T05883                                 

Gene name
LGMN
Definition
(RefSeq) legumain
  KO
K01369  legumain [EC:3.4.22.34]
Organism
mna  Miniopterus natalensis
Pathway
mna04142  Lysosome
mna04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107531602 (LGMN)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107531602 (LGMN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107531602 (LGMN)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     107531602 (LGMN)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C13: legumain family
   107531602 (LGMN)
SSDB
Motif
Pfam: Peptidase_C13 PseudoU_synth_2
Other DBs
NCBI-GeneID: 107531602
NCBI-ProteinID: XP_016061208
LinkDB
Position
Unknown
AA seq 438 aa
MPRHRMIWEVAVVLTLVLGTAAVPEDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQI
VHRNGIPDEQIVVMMYDDIANSEDNPTPGVVINRPNGSDVYKGVLKDYTGEDVTPQNFLA
VLRGDEEAVKGKGSGKVLKSGPRDHVFVYFTDHGATGLLAFPNDDLHVKDLNKTIQYMYK
HKKYQKMVFYIEACESGSMMRHLPTDINVYATTAANPDESSYACYYDEQRSTYLGDWYSV
NWMEDSDVEDLTKETLHKQYQLVKSHTNTSHVMQYGNKTISTMKLMQFQGVKHKASSPIS
LPPVHCLDLTPSPEVPLMIMKRKLMHTNDLQESRRLTEEIHRHLESRNVIEKSVRKIVSL
TTRSDDEVERLLSERAPLTEHDCYQAAVSHFRTYCFNWHSALYEYALRHLYVLVNLCEKP
YPVDRIKSSMDKVCLGYY
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcccaggcacaggatgatttgggaagtagccgtggtgctcaccttggtcctgggaact
gctgctgttcccgaggacgatcctgaggacggaggcaagcactgggtggtcatcgttgca
ggttcaaatggctggtataattataggcaccaggcagatgcatgccacgcctaccagatt
gttcaccgcaatgggattcccgatgagcagatcgttgtgatgatgtacgacgacatcgcc
aactctgaagacaaccccactccaggagttgtgatcaacaggcccaatggctcagatgtg
tacaaaggagtcctgaaggactacactggggaggatgtcaccccgcaaaatttccttgct
gtgttgagaggtgatgaagaagcagtgaagggcaaaggatctgggaaggtcttgaagagc
ggcccccgggaccacgtgtttgtttacttcactgatcacggagctactggactactggct
tttcctaacgacgatcttcatgtgaaggacctgaataagaccatccagtacatgtacaaa
cacaaaaagtaccaaaagatggtgttctacattgaagcctgtgagtctgggtccatgatg
agacacctgcccaccgacatcaatgtttatgcgacaactgccgccaatccagacgagtca
tcctacgcctgttactatgatgagcagaggtccacgtacctgggggactggtatagtgtc
aactggatggaggactcggatgtggaggacttgaccaaagagactctgcacaagcagtac
cagctggtgaagtcccacacaaacaccagccatgtcatgcagtatgggaacaagaccatc
tctaccatgaaactgatgcagtttcagggtgtgaaacacaaagccagttctcctatctcc
ctgcctcccgtccactgcctggacctcactccaagccccgaggtgcccctcatgatcatg
aagaggaaactaatgcacaccaatgacctgcaggagtccaggcgtctcactgaggagatc
cacaggcacctggagagcaggaatgtcattgagaagtcagtgcgaaagatcgtctccttg
accacgaggtccgacgacgaggtggagaggctcctgtcggagagagcgccgctcacggag
cacgactgctaccaggccgccgtgtcccacttccgcacctactgcttcaactggcactcg
gccctgtacgaatatgctctgcgccatttgtacgtgctggtcaacctctgtgagaaaccg
tatccagttgacagaataaaatcgtccatggacaaggtgtgccttggttactactga

DBGET integrated database retrieval system