KEGG   Miniopterus natalensis: 107531685
Entry
107531685         CDS       T05883                                 

Definition
(RefSeq) uncharacterized protein LOC107531685
  KO
K10784  T cell receptor alpha chain V region
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04064  NF-kappa B signaling pathway
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna04940  Type I diabetes mellitus
mna05135  Yersinia infection
mna05142  Chagas disease
mna05144  Malaria
mna05150  Staphylococcus aureus infection
mna05162  Measles
mna05166  Human T-cell leukemia virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05202  Transcriptional misregulation in cancer
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05321  Inflammatory bowel disease
mna05322  Systemic lupus erythematosus
mna05323  Rheumatoid arthritis
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107531685
   04015 Rap1 signaling pathway
    107531685
   04064 NF-kappa B signaling pathway
    107531685
   04020 Calcium signaling pathway
    107531685
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107531685
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107531685
   04660 T cell receptor signaling pathway
    107531685
   04658 Th1 and Th2 cell differentiation
    107531685
   04659 Th17 cell differentiation
    107531685
   04672 Intestinal immune network for IgA production
    107531685
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107531685
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107531685
  09163 Immune disease
   05310 Asthma
    107531685
   05322 Systemic lupus erythematosus
    107531685
   05323 Rheumatoid arthritis
    107531685
   05320 Autoimmune thyroid disease
    107531685
   05321 Inflammatory bowel disease
    107531685
   05330 Allograft rejection
    107531685
   05332 Graft-versus-host disease
    107531685
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107531685
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107531685
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107531685
   05150 Staphylococcus aureus infection
    107531685
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107531685
   05170 Human immunodeficiency virus 1 infection
    107531685
   05162 Measles
    107531685
   05169 Epstein-Barr virus infection
    107531685
  09174 Infectious disease: parasitic
   05144 Malaria
    107531685
   05142 Chagas disease
    107531685
SSDB
Motif
Pfam: DUF1968 V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 107531685
NCBI-ProteinID: XP_016061275
LinkDB
Position
Unknown
AA seq 276 aa
MTLATLLWTVAVSTCLGSSMAQTVTQPQPEISVQETETVTLGCTYDTSDSDYYLFWYKQP
PSGEMLFIIRQEAYKQQNATDNRFSVNFQKATKSFSLRISDSQLEDAAMYFCALKRKLCA
YSGVGAYQLTFGKGTKLLVTPNIKNPDPAVYQLRSPKSSNTSVCLFTDFDSKINVSQSLS
STVFGSNSTALDMKAVGSKSNGVLHWSQSSDFKCNETFDENFHSNSEVSCNAMLVEKSFE
TDMNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS
NT seq 831 nt   +upstreamnt  +downstreamnt
atgacacttgctaccttgctgtggacagtcgcggtctctacctgtcttggatccagcatg
gcccagactgtcactcagcctcaaccagaaatatctgtgcaagagacagagactgtgacc
ctgggctgtacatatgacactagtgatagtgattattatttgttctggtacaaacagcca
cccagtggggagatgctgttcattatccgccaagaagcttataagcaacaaaatgcaaca
gataatcgcttctctgtgaacttccagaaagcaaccaaaagcttcagcctcaggatctcc
gactcccagctggaggatgctgcgatgtatttctgtgccctcaaaaggaaactctgtgca
tactctggagttggggcttaccaactcactttcgggaagggcaccaaactcttggtcaca
ccaaatatcaagaaccctgaccccgccgtgtaccagctgagaagccctaaatccagcaac
acttcggtctgcctgttcaccgattttgattctaaaatcaatgtgtcacaaagcctgagc
tccacggtgtttggctctaacagcacggcgctggacatgaaggccgtgggttccaagagc
aatggggtgctgcactggagtcagagctctgacttcaaatgtaatgaaacctttgacgag
aacttccactccaattcagaagtttcctgtaatgccatgttggtagagaaaagctttgaa
acagatatgaacctaaacttccaaaacttgtctgtgatcgggttccgcatcctgctcctg
aaagtggccggctttaacctgctcatgaccctgcggctgtggtccagctga

DBGET integrated database retrieval system