KEGG   Miniopterus natalensis: 107531691
Entry
107531691         CDS       T05883                                 

Gene name
MMP14
Definition
(RefSeq) matrix metalloproteinase-14
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
mna  Miniopterus natalensis
Pathway
mna04668  TNF signaling pathway
mna04912  GnRH signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107531691 (MMP14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107531691 (MMP14)
   04928 Parathyroid hormone synthesis, secretion and action
    107531691 (MMP14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107531691 (MMP14)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     107531691 (MMP14)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M10
   107531691 (MMP14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M54 DUF4953 Metallopep HTH_17 Peptidase_M66 Reprolysin_3 SKG6
Other DBs
NCBI-GeneID: 107531691
NCBI-ProteinID: XP_016061288
LinkDB
Position
Unknown
AA seq 576 aa
MSPAPLPARSLLLPLLALVALSSAQSSFSPEAWLQQYGYLPPGDLRTHTQRLPQSLSAAI
AAMQRFYGLRVTGKADADTMKAMKRPRCGVPDKFGAEIKANVRRKRYAIQGPKWHHNEIT
FCIQNYTPKVGEYATYEAIRKAFRVWESHTPLHFREVPYSYILEGHEKQADIMIFFAEGF
HGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHAL
GLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGPTKMPPQPRTTSRPSFP
DKPKNPTYGPNICDGNFDTVAVLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPA
SINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDRIDAALFWMPNGK
TYFFRGNKYYRFNEELRAVDSEYPQNIKVWEGIPESPRGSFMGSNEVFTYFYKGNKYWKF
NNQKLKVEPGYPKSALRDWMGCPAGGRPDAGTEEETEVIIIEVDEEGSGAVSAAAVVLPV
LLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgtctcctgccccactgcccgcccgcagtctgctgctccccctgctcgcgctcgtcgcc
ctcagctcggcccaaagcagcttcagccccgaagcctggctgcagcagtatggctacctg
ccccctggggacctgcgtacccacacacagcgcttacctcagtcactctcagctgccatc
gctgccatgcagaggttctacggcctgcgagtgacaggcaaggctgatgcagacaccatg
aaggccatgaagcgcccccgctgtggtgttccagacaagttcggtgctgagatcaaggcc
aacgttcgaaggaagcgctatgctatccagggccccaaatggcatcataatgagattact
ttctgcatccagaattacacccccaaggtaggcgagtatgccacatatgaggccatccgc
aaggcattccgcgtgtgggagagtcacacaccgctgcatttccgagaggtaccctattcc
tacatcctcgagggccatgagaagcaggctgacatcatgatcttcttcgctgaaggcttt
catggcgacagcacgcccttcgatggcgaaggtggcttcctcgcacacgcctacttccca
ggccccaacattggaggggacacccactttgactctgctgagccctggactgtccaaaat
gaggatctgaatgggaatgacatctttctggtggctgtgcatgagctgggccatgccctg
ggcctcgagcattccaatgatccctcggccatcatggcacccttttaccagtggatggac
accgagaacttcgtgctgcctgacgatgaccgccggggcatccagcaactttatgggagt
aagtcaggccccaccaagatgccccctcaacccaggaccacctccaggccctctttccct
gataagcccaaaaaccccacctatgggcccaacatctgtgatgggaactttgacactgtg
gctgtgcttcgaggggagatgtttgtcttcaaggagcgctggttctggcgggtgaggaat
aaccaagtgatggatggctacccaatgcccatcggccagttctggcggggcctgcctgcg
tccatcaacactgcctacgagaggaaggacggcaaatttgtcttcttcaaaggagataag
cactgggtgtttgatgaagcttccctggaacctggctaccccaagcacattaaggagctg
ggtcgaggactgcctactgacaggattgatgccgctctcttttggatgcccaatggaaag
acctactttttccggggaaacaagtactaccgtttcaacgaggagctcagggcagtggac
agcgagtacccccaaaacatcaaggtctgggaaggaatccctgagtctcccagagggtca
ttcatgggcagcaatgaagttttcacgtacttctacaaggggaacaaatactggaaattc
aacaaccagaagctgaaagtagagccaggctaccccaagtcagccctgagggactggatg
ggctgccctgcggggggccggccagatgcggggactgaggaggaaacggaagtgatcatc
atcgaagtggacgaggaaggcagcggggcagtgagcgcggccgctgtggtgctgcctgtg
ctgctgctgctcctggtgctggcggtgggcctcgcagtcttcttcttcagacgccacggg
acccccaagcgactgctctattgccagcggtccctgctggacaaggtctga

DBGET integrated database retrieval system