KEGG   Miniopterus natalensis: 107531748
Entry
107531748         CDS       T05883                                 

Definition
(RefSeq) cytochrome P450 2J2
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1 1.14.14.73 1.14.14.74 1.14.14.75]
Organism
mna  Miniopterus natalensis
Pathway
mna00590  Arachidonic acid metabolism
mna00591  Linoleic acid metabolism
mna01100  Metabolic pathways
mna04726  Serotonergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107531748
   00591 Linoleic acid metabolism
    107531748
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107531748
  09156 Nervous system
   04726 Serotonergic synapse
    107531748
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107531748
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     107531748
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     107531748
    1.14.14.74  albendazole monooxygenase (hydroxylating)
     107531748
    1.14.14.75  fenbendazole monooxygenase (4'-hydroxylating)
     107531748
Cytochrome P450 [BR:mna00199]
 Cytochrome P450, animal type
  CYP2 family
   107531748
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107531748
NCBI-ProteinID: XP_016061381
LinkDB
Position
Unknown
AA seq 544 aa
MRHAMATTALPRVSAARIGNNRKCQKRERMGEGKLCAAQRRADALAAVLRAASCAFCRPP
PGWLLLGAAAFLLLAYFSKRRVPKNSPPGPWSLPVFGMFLQLDMKRPHLSIQKYVKEYGN
IFIMDISMWSSVLLTGLPLIKEALVQGQNIADRPRYPVQERICKNKGLIFSNGQEWKEQR
RFALMTLRNFGLGKRSLEARIQEEAYHLSQAMEEEKGQPFNPHFKINNAVSNIICSITFG
ERFEYQDGQFQEMLRLLDDVMHLEMSVWCHFYNSFPWIVQFLPGPHQQLFNKWEKLKLFI
SRVTENHKRDWNLDEPRDFIDAYLKEIEKHVGNAASSFNEENLIFCALDLFFAGTETTST
TLRWGLLYMALYPEIQEKVQAEIDRVLGQSQQPSVAARELMPYTNAVIHEVQRMGNIIPL
NVPRVASADTTLAGYHLPQGTMIMTNLTALHRDPAEWATPDTFNPEHFLENGQFKKREAF
LPFSIGKRVCLGEQLAKSELFIFFTSLLQKFTFKAPDNEELTLEFRTGITLSPVDHRLCA
VPRA
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgaggcatgccatggcaaccactgcgctgccgcgcgtcagcgccgccaggattggtaat
aatcgcaagtgtcaaaagcgagaacgaatgggggaaggaaagctgtgcgcagcccagcgg
cgagccgacgcgctggcggctgtgctgcgggccgccagctgcgccttctgccgcccccct
cccggctggctcctgctgggcgccgcagcctttctgctcctggcctatttctcgaaaagg
cgggtccccaagaactccccgccggggccctggagtctgcccgtcttcggaatgttctta
cagctggacatgaagcggccacacctgtcgattcagaagtatgtgaaggaatatgggaac
attttcatcatggacatcagcatgtggtcttcagtccttttaactggattgcctttaatc
aaagaggcccttgtccagggacaaaacatagcagaccgccccaggtaccctgttcaagaa
cggatctgtaagaataaaggcttgatcttttccaatggccaggaatggaaggagcaaaga
aggtttgccctgatgacactaaggaactttggtttaggaaagaggagcttagaggcacgc
atccaggaggaggcctaccacctcagccaggcgatggaagaggagaagggacagccattt
aaccctcacttcaagatcaacaatgcagtttccaatattatttgctccatcacctttggg
gaacgctttgagtaccaggatggtcagttccaagagatgctgaggttactggatgatgtc
atgcatctggagatgtcagtgtggtgtcacttctataacagctttccatggatagtgcaa
ttcctccctggaccccaccaacaactctttaacaaatgggagaagctgaaattgtttatt
tctcgtgtgactgaaaaccacaagagagactggaatcttgacgagccaagagattttatc
gacgcatacctcaaggaaatagaaaagcatgtgggcaatgcggcttccagtttcaatgag
gaaaacctcatcttctgtgctctggacctcttctttgctggaaccgagacaacttcgacg
acgctgcgctggggtctgctttacatggccctgtacccagaaatccaagaaaaagtgcaa
gctgagatcgacagagtgcttgggcagtctcagcagccgagcgtggctgctcgggagctc
atgccctacaccaatgccgtcatccacgaggtgcagaggatgggaaacatcatccccctg
aatgtgcccagggtagccagcgccgacaccacgctggccgggtaccacctgccccagggg
accatgatcatgaccaatctgactgcactgcacagggaccctgcagagtgggccaccccc
gacacatttaatccggaacactttctggagaatggacagtttaagaaaagggaagccttt
ctgcctttctcaatagggaagcgagtatgcctcggagaacagctggccaaatccgagctg
tttattttcttcacctcccttttgcaaaaatttacctttaaggccccagacaatgaggag
ctgaccctggaattcagaacaggaatcaccctctccccagtcgaccaccgcctctgtgca
gtccctcgggcttga

DBGET integrated database retrieval system