KEGG   Miniopterus natalensis: 107531805
Entry
107531805         CDS       T05883                                 

Gene name
LHB
Definition
(RefSeq) lutropin subunit beta
  KO
K08521  lutropin subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04917  Prolactin signaling pathway
mna04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107531805 (LHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107531805 (LHB)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107531805 (LHB)
   04912 GnRH signaling pathway
    107531805 (LHB)
   04913 Ovarian steroidogenesis
    107531805 (LHB)
   04917 Prolactin signaling pathway
    107531805 (LHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 107531805
NCBI-ProteinID: XP_016061442
LinkDB
Position
Unknown
AA seq 154 aa
MEMLQRSQAGPEAVALSQGLLLWLLLSVGGMRASRGPLRPLCRPINATLAAENEACPVCI
TFTTSICAGYCPSMVRVLPAPLPPVPQPVCTYRELSFASIRLPGCPPGVDPMVSFPVALS
CRCGPCRLSSSDCGGPRAQPLACDHPALPDLLFL
NT seq 465 nt   +upstreamnt  +downstreamnt
atggagatgctccagaggtctcaggctggccctgaggcagtggccttatcccaggggctg
ctgttgtggctgttgctgagcgtgggtgggatgcgggcatccagggggccactgcggccg
ctgtgccggcccatcaatgccaccctggccgccgagaatgaggcctgcccagtctgcatc
accttcaccaccagcatctgtgccggctactgccccagcatggtgcgggtactgccggcc
cctctgccgcctgtgccccagccggtgtgtacctaccgtgagctgagctttgcctccatc
cgactccctggctgcccgcctggtgtggacccaatggtctccttccctgtggccctcagc
tgtcgctgtgggccctgccgcctcagcagctctgactgtgggggtcccagagcccaaccc
ttggcctgtgaccaccccgccctcccagacctcctcttcctctaa

DBGET integrated database retrieval system