KEGG   Miniopterus natalensis: 107531901
Entry
107531901         CDS       T05883                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04071  Sphingolipid signaling pathway
mna04115  p53 signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04211  Longevity regulating pathway
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04722  Neurotrophin signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107531901 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107531901 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107531901 (BAX)
   04215 Apoptosis - multiple species
    107531901 (BAX)
   04217 Necroptosis
    107531901 (BAX)
   04115 p53 signaling pathway
    107531901 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107531901 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    107531901 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531901 (BAX)
   05202 Transcriptional misregulation in cancer
    107531901 (BAX)
   05203 Viral carcinogenesis
    107531901 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107531901 (BAX)
   05212 Pancreatic cancer
    107531901 (BAX)
   05225 Hepatocellular carcinoma
    107531901 (BAX)
   05226 Gastric cancer
    107531901 (BAX)
   05214 Glioma
    107531901 (BAX)
   05216 Thyroid cancer
    107531901 (BAX)
   05220 Chronic myeloid leukemia
    107531901 (BAX)
   05217 Basal cell carcinoma
    107531901 (BAX)
   05218 Melanoma
    107531901 (BAX)
   05213 Endometrial cancer
    107531901 (BAX)
   05224 Breast cancer
    107531901 (BAX)
   05222 Small cell lung cancer
    107531901 (BAX)
   05223 Non-small cell lung cancer
    107531901 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107531901 (BAX)
   05014 Amyotrophic lateral sclerosis
    107531901 (BAX)
   05016 Huntington disease
    107531901 (BAX)
   05020 Prion disease
    107531901 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    107531901 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107531901 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107531901 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107531901 (BAX)
   05152 Tuberculosis
    107531901 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107531901 (BAX)
   05170 Human immunodeficiency virus 1 infection
    107531901 (BAX)
   05161 Hepatitis B
    107531901 (BAX)
   05160 Hepatitis C
    107531901 (BAX)
   05164 Influenza A
    107531901 (BAX)
   05162 Measles
    107531901 (BAX)
   05168 Herpes simplex virus 1 infection
    107531901 (BAX)
   05163 Human cytomegalovirus infection
    107531901 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107531901 (BAX)
   05169 Epstein-Barr virus infection
    107531901 (BAX)
   05165 Human papillomavirus infection
    107531901 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107531901 (BAX)
   01524 Platinum drug resistance
    107531901 (BAX)
   01522 Endocrine resistance
    107531901 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mna03029]
    107531901 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107531901 (BAX)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    107531901 (BAX)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107531901 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 107531901
NCBI-ProteinID: XP_016061577
LinkDB
Position
Unknown
AA seq 194 aa
MSPGTSSLLSPLGPTNSEQIMKTGALLLQGFIQDQAARMGGETSQLPLGPRVPQDASTKK
LSECLKRIGDELDSNIELQRMIEAVDTDSPREVFFRVASEMFSDGNFNWGRVVALFYFAS
KLVLKALCTKVPELIRTIMGWTMDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVA
GVLTASLTIWKTMG
NT seq 585 nt   +upstreamnt  +downstreamnt
atgagtccaggcacctcttccctcctttctcctctagggcccaccaactctgagcagatc
atgaagacaggggcccttttacttcagggtttcatccaggatcaagcagcgcgaatgggg
ggagagacatcccagctgcccctggggcccagggtgccccaggatgcatccaccaagaag
ctgagcgagtgtctcaagcgcattggagatgaactggacagtaacatcgagctgcagagg
atgatcgaggctgtggacacagactccccccgtgaggtctttttccgagtggcgtccgaa
atgttttctgatggcaacttcaactggggccgggttgtcgccctcttctactttgccagc
aaactggtgctcaaggccctgtgcactaaagtgcctgagctcatcaggaccatcatgggc
tggaccatggacttccttcgagagcggctgctgggctggatccaagaccagggcggttgg
gacggcctcctctcctactttgggacacccacgtggcagacagtgaccatcttagtggcc
ggagtgctcactgcctcactcaccatctggaagacgatgggctga

DBGET integrated database retrieval system