KEGG   Miniopterus natalensis: 107531908
Entry
107531908         CDS       T05883                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
mna  Miniopterus natalensis
Pathway
mna00600  Sphingolipid metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna05152  Tuberculosis
Module
mna_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107531908 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107531908 (SPHK2)
   04371 Apelin signaling pathway
    107531908 (SPHK2)
   04020 Calcium signaling pathway
    107531908 (SPHK2)
   04072 Phospholipase D signaling pathway
    107531908 (SPHK2)
   04071 Sphingolipid signaling pathway
    107531908 (SPHK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107531908 (SPHK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107531908 (SPHK2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     107531908 (SPHK2)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 107531908
NCBI-ProteinID: XP_016061589
LinkDB
Position
Unknown
AA seq 722 aa
MTPPRQRVCPQLQWQWISRALGLSRCRPLRQARGSAGPTHREPSLVRLRPAGQPLAERRH
TPPHTPLGQMGAVGADLRGRLEEDPASEEGAGVRAGTRVWVTAGPRGTERRRPRTGVPGL
WDGDGEPEPGLRDPGMETQALHIQRLRPKPEARPRGGLVLLAEVSGCCTLRSRSPSDSVA
YFCIYTYQRGRRGGRRRATRTFGADGAATYEENRAEAQRWATVLTCLLRGLPLPGNGEIT
ANLLPRPPRLLLLVNPFGGRGLAWQLCKNHVLPMISEAGLSFNLIQTERQNHARELVQGL
SLSEWDGIITVSGDGLLYEVLNGLLDRPDWEEAMKTPVGILPCGSGNALAGAVNQHGGFE
QALGIDLLLNCSLLLCRGGCRPLDLLSVTLASGSRCFSFLSVAWGFISDVDIQSERFRAL
GSARFTLGMVLGLATLHTYRGRLSYLPATVEPASPTPAHGLPRAKSELTLAPVPPPPMAH
SPLHRSVSDLPLPLPQPALTSPDSPEPLPILSFNGGGPELARDWGGAGDAPLSPDPLLPS
PPGSPKSALLSPTTEGTPEMPASSGLLPPTPDGDPVVISTGGPPDHLLPPLGTPLPSGWV
TLEGDFVLMLAISPSHLGADLVAVPHARFDDGLVHLCWVRGGISRAALLRLFLAMEHGSH
FSLGCPQLGYAAAQAFRLEPLTPRGVLTVDGEQVEYGPLQAQVHPGLGTLLTGPPGHPGR
EP
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgacaccgcctcggcagcgcgtgtgccctcaactacaatggcagtggatctcgcgagcg
ctggggctctctcgctgcaggcccctgcgccaagctcgcgggtctgctggacccacccac
cgcgagccctcattggtgcggctcaggccagccggacagccattggctgagcggaggcac
actcccccacacacacccctgggtcagatgggggcggttggtgctgacttgaggggccgt
ttggaggaggacccggcgtctgaggagggtgcgggggtccgggcagggacgcgagtctgg
gttaccgcgggaccaagaggaacggagagacgcaggcccaggactggggtaccagggtta
tgggatggagatggagaaccagaaccggggctgagggatccaggaatggaaacccaggcc
ctgcacatacaacggctgcgcccaaagcctgaagccaggccccggggcggcctggtcctg
ctggctgaggtctcaggctgttgtaccctgcggagccgcagtccctctgactcagtggcc
tacttctgtatctacacttatcagcggggccggcgagggggccgacgcagagccacacgc
acctttggggctgatggggcagccacctacgaggagaaccgggctgaggcccagcgctgg
gccactgtcctcacgtgtctgctccgtggactgccactgcctgggaatggggaaatcacc
gccaatcttctgccaaggccaccccgattgctgctattggtcaatccctttggtgggcgg
ggcttggcttggcagttgtgtaagaaccacgtgctgcccatgatctccgaagctgggctg
tccttcaacctcatccagacagaacgacagaaccacgctcgggagctggtccagggactg
agcctgagcgagtgggatggcatcatcacagtctcaggagatgggctgctgtacgaggtg
ctgaatggactcctagatcgccccgactgggaagaggctatgaagactcctgtgggcatc
ctcccctgtggctcaggcaatgcattggctggagctgtgaaccagcatggggggtttgag
caggccctgggcattgacctgctgctcaattgctcactgctgctatgccggggtggctgc
cgcccgctggacctcctttctgtgaccctggcctcgggttcccgctgtttctccttcctg
tctgtggcctggggcttcatatcagatgtggacatccagagtgagcgcttcagggccttg
ggcagtgcccgcttcacactgggcatggtgctgggccttgccaccttgcacacctaccgt
ggacgcctctcctacctccctgccaccgtggagcctgcctcacccacccctgcccatggc
ctgcctcgtgccaaatctgagttgaccctggcccctgtcccacctccacccatggcccac
tcaccacttcatcgctccgtatctgacctgcccctgccactgcctcaacctgccctgacc
tcccctgactcacctgaaccactacccatcctgtcattcaatggtgggggcccagagctg
gccagggactggggtggggctggggatgctccactgtccccagacccactgctgccctca
cctcctggctcccccaagtcagctctactctcacccaccaccgaggggacaccagaaatg
ccagcatcctctgggcttctgcctcccacccctgatggtgacccagtagtcatctctact
ggaggtccaccagaccacctgctccctcctctgggaaccccgctaccctcaggctgggtg
acactggagggggactttgtgctcatgttggccatctcacccagccacctgggggctgac
ctcgtggcagttccccacgcacgctttgatgatggcctggtgcacctgtgctgggtgcgt
ggtggcatctcacgagctgcactgctgcgccttttcctggccatggagcatggtagccac
ttcagcctgggctgcccgcagctgggctatgccgcagctcaagcctttcgcctggagccg
ctcactccccgcggagtgctcacggtggatggggagcaggtggagtacgggcccctgcag
gcgcaggtgcatccaggcctcggtacactgctcactgggcctccaggccaccctgggcgg
gagccctga

KEGG   Miniopterus natalensis: 107536591
Entry
107536591         CDS       T05883                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
mna  Miniopterus natalensis
Pathway
mna00600  Sphingolipid metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04370  VEGF signaling pathway
mna04371  Apelin signaling pathway
mna04666  Fc gamma R-mediated phagocytosis
mna05152  Tuberculosis
Module
mna_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107536591 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107536591 (SPHK1)
   04371 Apelin signaling pathway
    107536591 (SPHK1)
   04020 Calcium signaling pathway
    107536591 (SPHK1)
   04072 Phospholipase D signaling pathway
    107536591 (SPHK1)
   04071 Sphingolipid signaling pathway
    107536591 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107536591 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107536591 (SPHK1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     107536591 (SPHK1)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 107536591
NCBI-ProteinID: XP_016067867
LinkDB
Position
Unknown
AA seq 396 aa
MDPAGGPQNLLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAQADVSFRLLLTERRNHA
RELVRAEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIRKPLCSLPAGSGNALAASL
NHYAGYQQVTNEDLLNNCTLLLCRRRLAPMNLLSLQMVSGLRVFSVLSLAWGFIADVDIE
SEKFRRLGEMRFTLGTILRLAALRVYQGRLAYLPAERVVSKVPASPALDRRDRQGPVDAH
LVPLEEPVPAHWTVVPEQDFVLVLALLHSHLGSEMFAAPMGHRAAGAMHLFYVRAGVSRA
MLLRLFLAMEKGRHMECDCPYLVYVPVVAFRLEPKDGKGMFAVDGELMVSEAVQGQVHPN
YFWMVSDRMEPSSPMGPQLPPPSRKSQQTPPPEDPL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggatccagccggcggcccccagaacctgctcccccggccctgccgcgtgctcgtgctg
ctcaacccgcgcggcggcaagggcaaggccctgcagctcttccggagccacgtgcagccc
ctgctggcgcaggccgacgtctccttcaggctcctgctcacggaacggaggaaccacgcc
cgcgagctggtgcgcgcggaggagctgggccgctgggacgcgctggtggtcatgtccgga
gacgggctgatgcacgaggtggtgaacgggcttatggagaggcccgactgggagaccgcc
atccggaagcccctgtgtagcctcccagccggttctggcaatgcgctcgcagcttctttg
aaccattacgcgggctaccagcaggtgactaacgaagacctcctgaacaactgcacgctt
ctgctgtgccgccggcgcctggctcccatgaacctgctgtcgctgcagatggtctccggg
ctgcgggtcttctccgtgctcagcctggcctggggcttcattgctgatgtggacatcgag
agtgagaagttccggcgcctgggggagatgcgcttcactctgggcaccatcctgcgcctg
gcagcgctgcgggtctaccagggccgcctggcctacctccccgccgaacgggtggtctcc
aaggtgcccgcctcccctgctctggaccggcgggaccggcagggccctgtggacgcccac
ctcgtgcccctggaggagccagtgcccgctcactggactgtggtgccagagcaggacttt
gtgctggtgctggcgctgctgcactcacacctgggcagcgagatgtttgctgcacccatg
ggccaccgtgcggctggcgccatgcatctgttctacgtgcgggcgggcgtgtctcgggcc
atgctgctgcgcctcttcctggccatggagaagggcaggcacatggagtgtgactgtccc
tacttggtgtatgtgcctgtggttgccttccgcctggagcccaaggatgggaaagggatg
tttgctgtggacggggagttgatggtcagtgaggctgtgcagggccaggtgcacccaaac
tacttctggatggtcagtgaccgcatggagccttcatcccctatggggccacagctgccg
ccccccagccggaagtctcagcagacgccacctccagaagatcccttgtga

DBGET integrated database retrieval system