KEGG   Miniopterus natalensis: 107531917
Entry
107531917         CDS       T05883                                 

Gene name
KCNA4
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 4
  KO
K04877  potassium voltage-gated channel Shaker-related subfamily A member 4
Organism
mna  Miniopterus natalensis
Pathway
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107531917 (KCNA4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107531917 (KCNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531917 (KCNA4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107531917 (KCNA4)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Other DBs
NCBI-GeneID: 107531917
NCBI-ProteinID: XP_016061608
LinkDB
Position
Unknown
AA seq 567 aa
MEVAMLSEEGEEEEEEEAEEDEDEEEEEEGRCYCSEDERADDSYSDPLPPEDAGGYGAAR
SRDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDA
ILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGDEALLKFREDEGFVREEEDRALPENEFK
KQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLILALGAGAGGPA
GLSNDTSAARAEGAGHTVFNDPFFIVETVCIVWFSFEFAVRCFACPSQALFFKNIMNIID
IVSILPYFITLGTDLAQQQQGGGPQPPPQQQQQQAMSFAILRIIRLVRVFRIFKLSRHSK
GLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTM
TTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETESEEQTQLAQG
AVSCPYLPSTLLKKFRSPTASSLGDKSEYLEMEEGVKESLCAKEKCPGKGGDGEAEKNSC
SXPRPRPGLSGAAFGRRECGWAGETCR
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggaggtcgcgatgctgagcgaggagggggaggaggaggaggaggaggaggcggaggag
gacgaggacgaggaggaggaggaggagggcaggtgctactgcagcgaggacgagcgcgcc
gacgactcctacagcgacccgctgccgcccgaggacgcgggcggctatggcgccgcgcgc
tcccgcgactgctgcgagcgcgtggtcatcaacgtctcgggcctccgcttcgagacgcag
atgaaaacgctggcccagttccccgagaccctgctgggggaccccgagaagaggactcag
tacttcgaccctttgcggaacgagtactttttcgaccggaaccggcccagctttgacgcc
atcctgtattactatcaatccgggggccgcctgaagaggcccgtcaacgtcccgttcgac
atcttcaccgaggaggtcaagttctaccagctgggcgacgaggccctgctcaagttccgg
gaggacgagggcttcgtgcgggaggaggaggaccgggccttgccggagaacgagttcaag
aagcagatctggcttctcttcgagtacccggagagctccagcccggcccggggcatagcc
atcgtctcggtcctggtcatcttgatctccatcgtcatcttctgcctggagaccttgccc
gagttccgggacgacagggacctgatcctggccctgggcgcgggcgcgggcgggcccgcg
gggctgtccaacgacacctcggcggcgcgcgcggagggcgcggggcacacggtcttcaac
gaccccttcttcatcgtggagacggtctgcatcgtctggttctccttcgagttcgccgtg
cgctgcttcgcctgccccagccaggcgctcttcttcaagaacatcatgaacatcatcgac
atcgtgtccatcctgccttatttcatcacgctgggcacggacctggcgcagcagcagcag
ggcggcggcccgcagccgccgccgcagcagcagcagcagcaggccatgtccttcgccatc
ctcaggatcatccgcctggtgcgggtgttccgcatcttcaagctgtcgcggcactcgaag
ggcctgcagatcctgggccacacgctgcgcgccagcatgcgggagctgggcctgctcatc
ttcttcctcttcatcggggtcatcctcttctccagcgccgtgtacttcgcggaggcggat
gagcccaccacccacttccagagcatcccggacgcgttttggtgggctgtggtgaccatg
acgaccgtgggctacggggacatgaaacccatcaccgtggggggcaagatcgtggggtcc
ctgtgcgccatcgcgggcgtcctgaccatcgccctgcccgtgcccgtgatcgtctctaac
tttaactacttctaccaccgagagaccgagagcgaggagcagacgcagctggcgcagggc
gcagtcagctgtccctacctcccttccaccctgctgaagaagtttcggagccccaccgcc
tcctccctgggagacaagtcagagtacctggagatggaggagggagtgaaggagtccctc
tgtgccaaggagaagtgtccggggaaggggggcgacggcgaggcggagaagaacagctgt
tccncgccgcgcccccggcccggcctctccggagccgcgttcgggcggagagagtgcggc
tgggccggggagacgtgcagatga

DBGET integrated database retrieval system