KEGG   Miniopterus natalensis: 107531918
Entry
107531918         CDS       T05883                                 

Gene name
FSHB
Definition
(RefSeq) follitropin subunit beta
  KO
K05250  follitropin subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107531918 (FSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107531918 (FSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107531918 (FSHB)
   04913 Ovarian steroidogenesis
    107531918 (FSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 107531918
NCBI-ProteinID: XP_016061609
LinkDB
Position
Unknown
AA seq 129 aa
MKSVQLCFLFCCWKAMCCNGCELTNITITVEKEECRFCLSINTTWCAGYCYTRDLVYKDP
TRRNMQKVCTFKELAYETVRVPGCAHHADSVYTYLVATECHCGKCNRDNTDCTVQGLGPS
YCSFSKINE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaagtcggtccagttgtgctttcttttctgttgctggaaagcaatgtgctgcaacggc
tgtgagctgaccaacatcaccatcacagtggagaaggaagaatgccgcttctgccttagc
atcaataccacctggtgtgcgggctactgctacacccgggatctggtgtacaaggaccca
accaggcgcaatatgcaaaaagtatgtaccttcaaggaactggcgtatgagacggtgaga
gtgcctggctgtgctcaccatgcagactccgtgtacacatacctagtagccactgaatgt
cactgcggcaagtgtaacagagacaatactgactgcaccgtgcaaggcctggggcccagc
tactgctccttcagcaaaataaacgaataa

DBGET integrated database retrieval system