KEGG   Miniopterus natalensis: 107531918
Entry
107531918         CDS       T05883                                 

Gene name
FSHB
Definition
(RefSeq) follitropin subunit beta
  KO
K05250  follitropin subunit beta
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107531918 (FSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107531918 (FSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107531918 (FSHB)
   04913 Ovarian steroidogenesis
    107531918 (FSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 107531918
NCBI-ProteinID: XP_016061609
LinkDB
Position
Unknown
AA seq 129 aa
MKSVQLCFLFCCWKAMCCNGCELTNITITVEKEECRFCLSINTTWCAGYCYTRDLVYKDP
TRRNMQKVCTFKELAYETVRVPGCAHHADSVYTYLVATECHCGKCNRDNTDCTVQGLGPS
YCSFSKINE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaagtcggtccagttgtgctttcttttctgttgctggaaagcaatgtgctgcaacggc
tgtgagctgaccaacatcaccatcacagtggagaaggaagaatgccgcttctgccttagc
atcaataccacctggtgtgcgggctactgctacacccgggatctggtgtacaaggaccca
accaggcgcaatatgcaaaaagtatgtaccttcaaggaactggcgtatgagacggtgaga
gtgcctggctgtgctcaccatgcagactccgtgtacacatacctagtagccactgaatgt
cactgcggcaagtgtaacagagacaatactgactgcaccgtgcaaggcctggggcccagc
tactgctccttcagcaaaataaacgaataa

KEGG   Miniopterus natalensis: 107532807
Entry
107532807         CDS       T05883                                 

Gene name
CGA
Definition
(RefSeq) glycoprotein hormones alpha chain
  KO
K08522  glycoprotein hormones alpha chain
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04917  Prolactin signaling pathway
mna04918  Thyroid hormone synthesis
mna04923  Regulation of lipolysis in adipocytes
mna04929  GnRH secretion
mna05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107532807 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107532807 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107532807 (CGA)
   04929 GnRH secretion
    107532807 (CGA)
   04912 GnRH signaling pathway
    107532807 (CGA)
   04913 Ovarian steroidogenesis
    107532807 (CGA)
   04917 Prolactin signaling pathway
    107532807 (CGA)
   04918 Thyroid hormone synthesis
    107532807 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107532807 (CGA)
SSDB
Motif
Pfam: Hormone_6 PDGF Styelin
Other DBs
NCBI-GeneID: 107532807
NCBI-ProteinID: XP_016062777
LinkDB
Position
Unknown
AA seq 120 aa
MDYYRKHAAVVLAALSVLLHLLHSFPDGEFTMQVCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVKVENHTECHCSTCYYHKS
NT seq 363 nt   +upstreamnt  +downstreamnt
atggattactatagaaaacacgcagctgtggtcctggccgccctgtctgtgctcctgcac
cttctccattcctttcccgatggcgagttcacaatgcaggtttgcccagagtgcaagcta
aaggaaaacaaatacttctccaagctgggtgccccaatttaccaatgcatgggctgctgc
ttctccagagcatatcccactccagcaaggtccaagaaaacgatgttggtcccaaagaac
atcacctcagaagctacgtgctgtgtggccaaagcatttaccaaggccacagtaatggga
aatgtcaaagtggagaaccacacagagtgccactgcagtacttgctattatcacaaatct
taa

DBGET integrated database retrieval system