KEGG   Miniopterus natalensis: 107531936
Entry
107531936         CDS       T05883                                 

Gene name
ANO3
Definition
(RefSeq) anoctamin-3
  KO
K19498  anoctamin-3
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531936 (ANO3)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107531936 (ANO3)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer DUF2976 Ferric_reduct
Other DBs
NCBI-GeneID: 107531936
NCBI-ProteinID: XP_016061634
LinkDB
Position
Unknown
AA seq 835 aa
MNYIASSGLLFKDGKKRIDYILVYRKSNIQYDKRNTFEKNLRAEGLMLEKEPAVANADIM
FIKIHIPWDTLCKYAERLNIRMPFRKRSYYTDQRSKSTGSVHSYFRRLKKWMSQNPMVLD
KSAFPDLEESDCYTGPFSRARIHHFIINNKDTFFSNATRSRIVYHMLQHTKYENGISKVG
ICKLINNGSYIAAFPPHEGAYKSSQPSRTHGPQNNRRLLYERWARWGMWYKHQPLDLIRL
YFGEKIGLYFAWLGWYTGMLIPAALVGLCVFFYGIFTMNTSQVSQEICKATEVFMCPLCE
KNCSLQRLNESCIYAKVTYLFDNGGTVFFAIFMAIWATVFLEFWKRRRSTLTYTWDLIEW
EEEEETLRPQFEAKYYKMERVNPISGKPEPHQPSSDKVSRLLVSISGIFFMISLVITAVF
AVVVYRLVVMEQFASFKWNFIKQHWQFATSAAAVCINFVIIMALNLAYEKIAYLLTNLEY
PRTESEWENSFALKMFLFQFVNLNSSIFYIAFFLGRFVGHPGNYNKLFNRWRLEECHPSG
CLIDLCLQMGVIMFLKQIWNNFMELGYPLIQNWWSRHKIRRGIQDASIPQWENDWNLQPM
NIHGLMDEYLEMVLQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLPARA
TDIGIWYGILEGIGILAVITNAFVIAITSDYIPRFVYEYKYGPCASHFRYGENCLKGYVN
NSLSFFDLSELGMGKSGYCRYRDYRGPPWSSRPYEFTLQYWHILAARLAFIIVFEHLVFG
IKSFIAYLIPDVPKNLYDRIRREKYLVQEMMYEAELEHLQQQRRKSGHPVHHEWP
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgaattacatagcatccagtggactgctattcaaagatggcaaaaagcggatcgattac
atcctggtttatagaaagtcaaatatacaatatgacaaaagaaacacatttgaaaagaac
ctcagggcagaaggcttgatgttggaaaaggagccagctgttgcaaacgctgatatcatg
tttattaaaattcacattccgtgggacacgctgtgcaagtatgcagagaggctgaatatc
aggatgcccttcaggaaaagatcctattacacagaccagaggagcaaatcaacgggcagt
gtacacagctattttagaagactcaaaaaatggatgtctcagaacccaatggttctcgac
aagtcggctttcccagacctggaagagtcagattgctacacgggccccttcagccgcgcg
cggattcaccatttcataataaacaacaaggacaccttcttcagcaacgccactcggagc
aggatagtctaccacatgctgcagcacaccaaatatgaaaatgggatatcaaaagtgggt
atctgtaaactgataaacaatggctcgtatatagcagcttttcccccacatgagggagcc
tacaagagcagccagcccagcagaacgcacgggcctcagaataacaggcgcctgctgtat
gagcgctgggcacgctggggcatgtggtacaagcaccagcccctggacttaatcaggctc
tattttggtgagaagatcgggctatacttcgcgtggctggggtggtatactggaatgctg
attccggcagcactggttggcttgtgtgttttcttctatggaatatttacaatgaataca
agccaagtaagccaagaaatttgcaaggccactgaagtctttatgtgccctctctgtgaa
aagaactgctcactgcagagactcaacgaaagctgtatctatgccaaggtgacatacttg
tttgataatggagggacagtcttctttgctatttttatggcaatatgggccacagtcttc
ctggagttctggaaaaggagaagaagtacactgacctatacttgggatcttattgaatgg
gaagaagaggaggaaacacttcgtccccagtttgaagcaaagtattataagatggagaga
gtgaatcccatcagtggaaaacccgagccgcatcagccttcttcagacaaagtcagtcgt
ctccttgtttctatctcaggaatattcttcatgatatctttggtgatcactgcagtgttt
gcagttgtggtgtatcgcctggtggttatggaacagtttgcatcattcaagtggaatttc
atcaaacagcactggcagtttgcaacatctgctgctgctgtctgtatcaattttgtaatc
atcatggccctgaatcttgcttatgaaaaaattgcttaccttctcactaatttagaatat
cctcgaacagagtctgagtgggaaaacagctttgccctgaagatgttcctcttccagttt
gtcaatttgaacagttctatcttctatatcgctttctttttggggagattcgtaggccac
ccaggaaattacaataaactttttaaccggtggagactggaggaatgtcatcctagtggc
tgcttgatagacctctgcctccagatgggagtgatcatgtttttgaagcaaatatggaac
aacttcatggaactgggttacccgctgatccagaactggtggtcacgacataaaatcagg
aggggaatccaagatgcttctatacctcagtgggaaaatgactggaatctgcagcccatg
aatattcacggactgatggatgaatacttagaaatggttttgcaatttggttttaccacc
atatttgttgcggcttttcctctggcgcctcttttggctttgttaaacaacatcattgaa
atcaggctggatgcatacaaatttgtcacccagtggcggaggcctctgccggcccgagca
actgacataggtatctggtatggaattcttgaaggaattggtatattggccgtgatcacc
aatgcgtttgtaattgctatcacgtctgattacatcccacgttttgtctatgaatacaaa
tatggcccctgtgcaagtcatttcagatatggtgaaaattgtctaaagggatatgtcaac
aatagcctatccttctttgacctgagtgagcttggtatgggaaaatctggttattgcaga
taccgagactacagagggcccccttggagttctagaccctatgagttcaccttacaatac
tggcacatcctcgctgctcggttggccttcattatcgtgtttgagcaccttgtctttggg
atcaagtcattcatcgcatacctgattccagatgtaccaaagaacctttatgaccgaata
cgacgggagaagtacttagtccaagaaatgatgtatgaggctgagctagagcatttgcaa
caacaacggagaaaaagtggtcatcctgttcaccatgaatggccttag

DBGET integrated database retrieval system