KEGG   Miniopterus natalensis: 107532136
Entry
107532136         CDS       T05883                                 

Gene name
SERPINA7
Definition
(RefSeq) thyroxine-binding globulin
  KO
K20734  thyroxine-binding globulin
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107532136 (SERPINA7)
Peptidases and inhibitors [BR:mna01002]
 Peptidase inhibitors
  Family I4: serpin family
   107532136 (SERPINA7)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 107532136
NCBI-ProteinID: XP_016061872
LinkDB
Position
Unknown
AA seq 414 aa
MPLFLSLVLLIFGLHCAPLNSSEGKVTTCHSPQQNATLYKMSSINADFAFNLYRRFTVET
PDRNIFFSPVSISTALAMLSTGACSSTQTQILESLGFNLTDTPMAEIQQGFQHLICSLNF
PKKELELQMGNALFIGKQIKPSPKFLDDVKNLYETEVFSTNFSNVSAAQQAINSHVEKQT
KGKVVGLIQDLKPSTIMVLVNYIHFKAQWANPFDPSKTEEGSSFLVDKTTTVQVPMMHQM
EQYYHLVDTELNCTVLQMDYSKNALALFVLPKEGQMEWVEGAMSSKTLKKWNRLLQKGWI
DLFVPKFSISATYDLGTILLKMGIQDAFADNADFSEVTEDNGLKLSKAAHKAMLHIGEKG
SEAVTVPEVRFLDQAEITLLHPIIQLDRSFLLLILEKNTRSILFLGKVVNPTKV
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgccactgttcctctctctggttctgttgatatttgggcttcattgtgcaccacttaac
agctctgaaggcaaagtaaccacctgccattccccccaacaaaatgccactctctataag
atgtcatctatcaatgctgactttgcattcaacctgtaccggaggttcactgtggagacc
ccagatcggaacattttcttttctcctgtgagcatttctacagctttggccatgctatcc
actggggcctgctccagcacccaaactcaaattctggaaagcttggggttcaacctcaca
gatactccaatggcagagatccagcagggctttcagcacttgatctgttcactaaacttt
ccaaagaaggagctggaattacagatgggaaatgccctctttattgggaagcagataaaa
ccatcaccaaagttcttggatgatgtcaaaaacctatacgagactgaagtcttttctacc
aacttctccaatgtttctgcagcccagcaggcaatcaatagtcatgtggagaagcaaacc
aaagggaaagttgtgggccttatccaagacctcaaaccaagcaccatcatggtcctggtg
aactatattcactttaaagcccagtgggcaaatccttttgatccatccaagacagaagag
ggttccagcttcttagtggacaagaccacaacagtgcaagtgcccatgatgcaccagatg
gaacaatactatcacttggtggatacggagctgaactgcacagtgctgcaaatggactat
agcaagaatgctctggcactctttgtccttcccaaggagggccagatggagtgggtggaa
ggggccatgtcatctaaaacactgaagaagtggaaccgcttactgcagaaggggtggatt
gacttgtttgttccaaagttttccatttctgctacatatgaccttggaaccatccttctg
aagatgggcatccaggatgcctttgctgacaatgcagatttttctgaagtcacagaggac
aatggtcttaaactttccaaagctgcccacaaggctatgctgcacattggtgaaaaggga
tccgaagctgtaactgtccctgaagtcagatttctggatcaggctgagataactctcctt
caccctatcatccaattagatagatctttcctattgttaattttggagaaaaataccagg
agcattctctttctagggaaagttgtgaacccaacaaaggtgtag

DBGET integrated database retrieval system