KEGG   Miniopterus natalensis: 107532213
Entry
107532213         CDS       T05883                                 

Gene name
PPP1R14A
Definition
(RefSeq) LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 14A
  KO
K12328  protein phosphatase 1 regulatory subunit 14A
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107532213 (PPP1R14A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107532213 (PPP1R14A)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107532213 (PPP1R14A)
SSDB
Motif
Pfam: PP1_inhibitor
Other DBs
NCBI-GeneID: 107532213
NCBI-ProteinID: XP_016061995
LinkDB
Position
Unknown
AA seq 155 aa
MAAQRLGKRGLSKLQAPSRSRGPGGSPGGLQKRHARVTVKYDRRELQRXXXXXXXXRLDV
EKWIDGRLEELYRGREADMPDEVNIDELLELENEEDRSQKIQGLLKSCMNPTEDFVQELL
VKLRGLHKQPGLRQPSPSSDRSLSPLQDRARTSRP
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgctcagcggctgggcaagagggggctgagcaagctgcaggctccgtctcggtcc
cgcggtccagggggcagccccggggggctgcagaaacgccacgcgcgagtcacagtcaag
tacgaccggcgggagctgcagcggnnnnnnnnnnnnnnnnnnnnnnngcggctggacgtg
gagaagtggatcgacgggcgattggaggagctataccgcggcagggaggcagacatgcct
gatgaagtcaacattgacgagttgttggaattagagaatgaagaggacagaagccagaaa
atccaggggctcctgaaatcgtgcatgaaccccacagaggacttcgtccaggaactactg
gtgaagctgcgaggcctccacaagcagccaggcctccgccagcccagcccctccagtgac
cgcagcctgagccccctccaggaccgggcccggacctcacggccctga

DBGET integrated database retrieval system