KEGG   Miniopterus natalensis: 107532216
Entry
107532216         CDS       T05883                                 

Gene name
CNGB1
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic nucleotide-gated cation channel beta-1
  KO
K04952  cyclic nucleotide gated channel beta 1
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04740  Olfactory transduction
mna04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107532216 (CNGB1)
   04022 cGMP-PKG signaling pathway
    107532216 (CNGB1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    107532216 (CNGB1)
   04740 Olfactory transduction
    107532216 (CNGB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107532216 (CNGB1)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   107532216 (CNGB1)
SSDB
Motif
Pfam: cNMP_binding
Other DBs
NCBI-GeneID: 107532216
NCBI-ProteinID: XP_016062000
LinkDB
Position
Unknown
AA seq 1205 aa
MLGWVQRVLPQPPGTPQKTRMEEEEGAEPEPEPDLEAELEPVPEPERAPQEAKLEDESLP
PEEPSEGEEEAAADPNPQETQKAASTPRTCLQAQVAVIPTVNSPSTWVLTWLRKGVEKVV
PQPVHSRGPAQSTAASLEGPDQAGAQILGHCSTRASDGSSEASRAKDTGPGPWLLRWFEQ
NLEKVLPQPPKTSEGCREEPADIAMGPEPPGCALEMEPMLQALETHPLPTPGPPEPEEEL
TPEPQPSFQASSLPPPGDIARLVAWLLHRLEMVLPQPVLREEAGAQEPDSPVTCDVQSIS
ILPGGQEEPNLVLEGADPPWEEGELPDGSEAVASAHEGEKEAVEGMHRELPWIQEEKEDE
EEEEPDQGDEEEPESAEKEAHVLLDSCLVAEAGQDPSGVDRTVTRRASCQDYSKAPGTWL
LSLXLSPPSSPQVPATEEHPEVRVEDTNADSHPHTVEDKPPSPELLPPSPAKSDTLTVPG
SAAGTHRKRLPSQDDEVEELKVLSPAETPVVAWSDTPVPQGTDSQDRSSSTASQNSAIIN
ERLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPANKAPEPAPDTKPDEAVQVEEEH
YCDMLCCKFKRRPWKKYEFPQSIDPLTNLMYILWLFFVVLAWNWNCWLIPVRWAFPYQTP
DNIHLWLLMDYLCDFIYVLDITVFQMRLQFVKGGDIITDKKEMRNNYLKSPRFKMDVLCL
LPLDFLYLKFGVNPLLRLPRCLKYLAFFEFNSRLESILSKAYVYRVIRTTAYLLYSLHLN
SCLYYWASAYQGIGSTHWVYDGVGNSYIRCYYWAVKTLITIGGLPDPKTLFEIVFQLLNY
FTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTW
HSQGMLDESELMVQLPDKMRLDLAIDVNYDIVSKVALFQGCDRQMIFDMLKRLRSVVYLP
NDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVFGEISLLAAGGGNRRTAN
VAAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLKNNNKPKEKSVLILPPRAGTP
KLFNAALAAAGKMGVQGAKGGKLAHLRARLKELAALEAAAKQQQLLEQAKSSEDAVGEEG
SAAPDQPAPPEPPAPGSQPPASPGRAEKEAAGPEEHMVRIHMSPGVDPGEQILSVEIPEE
RKEAE
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgttgggctgggtccagagggtgctgcctcagcccccagggacccctcagaagaccagg
atggaggaggaggagggggcagaaccagagccagagcctgacctggaggcagagctggaa
ccagtgccagagcctgaaagagccccccaggaggccaagctagaagatgagtccctgcca
cccgaggagccatctgaaggggaagaagaagctgcggctgacccaaaccctcaggagacc
cagaaggctgcctctactccacgcacatgtcttcaggcccaggttgctgtgattcccaca
gtgaacagtcccagcacctgggtgctgacctggctcaggaagggcgtggagaaggttgtc
ccacagcctgtccatagccgtgggcccgcccagagcactgcggccagcctggagggccca
gatcaggcaggagcacagatccttgggcactgcagcactagggcctcagatggatccagt
gaggcctccagggcaaaggacactgggcctgggccctggctgctcaggtggtttgagcag
aatctggagaaagtgctgcctcagcctccaaaaacctccgagggctgcagagaagagcct
gcagacattgccatgggcccagagcccccaggatgtgccttggaaatggagcccatgctg
caggccctggagactcatcccctgcccactcctggccccccagagcctgaggaggagctg
actccagagccccagcccagcttccaggcttcttccttgccaccccctggggacattgcc
aggttggtggcgtggctcctgcatagactggagatggtcctgccacagccagtgctccgt
gaggaggctggggcacaggagcctgactcccctgtgacatgtgacgtgcagtccatcagc
atcctccccggagggcaagaggagcccaatctcgtcctagaaggggctgaccctccctgg
gaggagggcgagcttccggatggctcagaggcggtggcttcagctcacgaaggagagaag
gaggccgtggaagggatgcacagggagcttccctggattcaagaggagaaagaagatgaa
gaggaggaagagcctgaccagggagatgaggaggagccagaaagtgctgagaaagaggct
catgtcctgctggatagctgtctggtggcagaggccggccaggacccgagtggagtagac
aggacggtcacccggagggcctcatgccaggattacagcaaggctcctgggacctggctt
ctctctctctgactgtcccctccttcctctccccaagtgcctgccactgaagagcaccca
gaagtgcgggtagaagataccaatgctgacagccacccccacaccgtggaggacaagccc
ccctcgcctgagctgttgccgccttctcctgccaaatccgacaccctcacagtcccagga
tcagctgcagggacccacaggaagaggctgccttcccaagatgacgaagtcgaagagctc
aaggtgctgtcacctgctgagacccccgttgttgcctggtcagacacccccgtcccacag
ggcaccgacagccaggaccgctcgtcctccacagccagccagaacagcgccatcatcaac
gagcggctccaggagctggtgaagctcttcaaggagcgcacggagaaggtgaaggagaag
ctcatcgacccagacgtcacgtccgatgaggagagccccaagccctctccagccaacaaa
gccccagagccagcccctgacacgaagccagatgaggcggtgcaggtggaggaggagcac
tactgtgacatgctctgctgcaagttcaaacgccgcccctggaagaagtacgagtttccc
cagagcattgacccactgaccaacctgatgtacatcctgtggctgttcttcgtggtgctg
gcctggaactggaactgctggctgatccctgtgcgctgggccttcccctaccagacgccc
gacaacatccacctctggctgctgatggattacctgtgcgacttcatctatgtcctggac
atcaccgtgttccagatgcgcctgcagtttgtcaagggaggagacatcattacggacaaa
aaagagatgcgcaataactacctgaagtctcctcgctttaagatggacgtgctctgccta
ctgcccttggactttctctacttgaaattcggcgtgaatcccctcctgcgtttgccccgc
tgtctgaagtatctggccttctttgagtttaacagccgcctggaatccatcctcagcaaa
gcctatgtttacagggttatcaggaccaccgcctacttgctctacagtttgcatttgaac
tcgtgtctgtattactgggcgtcggcctatcagggcatcggctccactcactgggtttat
gatggcgtgggaaacagttacattcgctgttactactgggctgtgaagaccctcatcacc
attggtggactgcccgaccccaagacgctgttcgagattgtcttccagctgctgaactat
ttcaccggtgtctttgctttctccgtgatgatcggacagatgagagatgtggtgggggcc
gccacggcggggcagacctactatcgcagctgcatggacagtactgtgaagtacatgaac
ttctacaagatccccaggtcggtgcagaaccgcgtcaagacctggtacgagtacacctgg
cactcccaaggcatgctggacgaatcggagctgatggtgcagcttccagacaagatgcgg
ctggacttggccatcgacgtgaactacgacattgtcagcaaagtggcgctcttccagggc
tgtgaccggcagatgatcttcgacatgctgaagcggctgcgctctgttgtctacctgccc
aatgactacgtgtgcaagaagggagagataggccgggagatgtacatcatccaggcgggg
caggtgcaggtcttgggtggccctgatgggaagtccgtgctggtgacactgaaagctgga
tctgtatttggagaaataagcttgctggctgctgggggcgggaatcggcgcacggccaac
gtggcggcccacgggttcaccaacctcttcatcctggacaagaaggacctgaatgaaatt
ttggtgcattaccccgagtctcagaagttactccggaagaaggccaggcgcatgctgaaa
aataacaacaagcccaaggagaagagcgtgctcatccttcctccccgggccggcaccccc
aagctcttcaacgctgccctggctgctgcaggaaagatgggtgtccagggggcaaaaggc
ggcaagctggcccacctcagggctcggctcaaagagctggctgcgctggaggcggctgcg
aaacagcaacagttgctagaacaggccaagagctcggaagacgccgtgggagaggagggc
tctgccgcccctgaccagcctgcacccccggaacccccggccccaggctctcagccacct
gcctccccagggcgcgccgagaaggaggctgctggtccagaggagcacatggtgcggatc
cacatgagcccgggtgtagaccctggagaacagatcctgtcggtggagatcccggaggag
aggaaagaggcggagtga

KEGG   Miniopterus natalensis: 107539359
Entry
107539359         CDS       T05883                                 

Gene name
CNGA2
Definition
(RefSeq) cyclic nucleotide-gated olfactory channel
  KO
K04949  cyclic nucleotide gated channel alpha 2
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107539359 (CNGA2)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107539359 (CNGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107539359 (CNGA2)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   107539359 (CNGA2)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding Ion_trans_2 GAS Mod_r
Other DBs
NCBI-GeneID: 107539359
NCBI-ProteinID: XP_016071310
LinkDB
Position
Unknown
AA seq 664 aa
MTEKSNGVTSSPANNHNHHAPPAIKANGKDDHRTSSRPQSATEDDTSSELQRLAELDAPQ
WRRGGFRRVILLVGVIREWTNKNFRKEEPRPDSFLERFRGPELQTVTTQQGDGKGNKDGE
GRGTKKKFKLFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDY
FSDVIYIADLFIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLVYFAVGI
HSPELRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIKWFDYLWTNK
KTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVAATMEVDVQEK
LEQLETNMETLYTRFSRLLAEYTGAQQKLKQRITILETKMKQNNEDDYLSDGVNSPEPAL
AEKS
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgacagaaaaatctaatggtgtgacgagctccccagccaataaccacaaccatcatgca
cctcctgccatcaaggccaatggcaaagatgatcataggacgagtagcaggccacagtct
gccactgaagatgacacctcctcagaactgcagaggctggcagagttggatgccccccag
tggaggaggggtggtttccgcagggtcatcctcctggtgggagtcattagagagtggact
aataagaatttccgaaaggaggaacctagacctgactcgttccttgagcgtttccgtggt
cctgagctccagacggtgacaacacagcaaggagatggcaaaggcaacaaggatggcgag
ggcagaggcaccaagaagaaattcaaactatttgtcttggacccagctggggactggtac
taccgctggctatttgtcattgccatgcctgttctctacaactggtgcctgctggtggcc
agagcctgcttcagtgacctacagaaaggctactacctagtgtggctggtgttggactac
ttctcagatgtgatctatattgcagacctcttcatccggttgcgcacaggtttcctagag
caggggctgctggtcaaagatcccaagaagctgcgggacaactacatccacactctgcag
ttcaagctagatgtggcttctatcatccccacagacctagtctattttgctgtgggcatc
cacagccctgagctgcgcttcaaccgcctgctacactttgcccgcatgtttgaattcttt
gaccgcaccgaaacacgcaccagttaccccaatatcttccgcatcagcaacctggttctc
tacatcttggtcatcatccactggaatgcctgcatctactatgccatctccaagtccatt
ggctttggggttgacacctgggtttatcccaacatcactgaccctgagtatggctacctg
gctagggaatacatctactgcctttactggtctacactgaccctcacaaccattggggag
acaccaccccctgtaaaggatgaggagtacctgtttgtcatctttgatttcctgattggt
gtcctcatctttgccaccatagtgggaaacgtgggctccatgatctccaacatgaatgcc
acccgggctgagttccaggccaagatcgatgcggtcaaacattacatgcagttccgcaag
gtcagcaaggagatggaagccaaggtcattaagtggtttgactacctgtggactaataag
aagactgtggatgagcgggaagttctcaaaaacctgccagccaagctgagggctgagata
gccatcaatgtccacctgtccacactcaagaaagtgcgcatcttccaggattgtgaggct
ggcttgctggtggagctggtattgaagcttcgtcctcaggtcttcagccctggggattac
atttgccgcaagggggatattggcaaggagatgtacataatcaaggagggcaagttggca
gtggtggctgatgatggtgtcactcagtatgccctgctctcagctgggagttgctttgga
gagatcagtatacttaacattaagggtagcaaaatgggcaatagacgcacggccaatatc
cgcagcctgggctactcagatctcttctgcttgtccaaggatgatcttatggaagctgtg
actgagtaccctgatgccaagaaggtcttggaggagaggggccgggagattctgatgaaa
gaggggctgctggatgagaatgaggtggcagccaccatggaggttgatgtgcaggagaag
ctagaacagctggagaccaacatggagactttatacactcgctttagccgcctgctggct
gagtacacgggggcccagcagaagctcaagcagcgcatcactattctggaaacaaagatg
aagcagaacaatgaggatgattacctttctgatggggtgaacagccccgagccagctctt
gctgaaaagtcataa

KEGG   Miniopterus natalensis: 107540490
Entry
107540490         CDS       T05883                                 

Gene name
CNGA4
Definition
(RefSeq) cyclic nucleotide-gated cation channel alpha-4
  KO
K04951  cyclic nucleotide gated channel alpha 4
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107540490 (CNGA4)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107540490 (CNGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107540490 (CNGA4)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   107540490 (CNGA4)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding
Other DBs
NCBI-GeneID: 107540490
NCBI-ProteinID: XP_016072747
LinkDB
Position
Unknown
AA seq 575 aa
MSQDSKVKTTESSPPAPSKARKALPVLDPSGDYYYWWLNTMVFPVMYNLVIIVCRACFPD
LQHDYLVAWLVLDYTSDLLYLLDIVVRFHTGFLEQGILVVDKGRIGRRYVRTWSFCLDLA
SLLPTDAAYARLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAHPNAFRIAKLMLYIFVVI
HWNSCLYFALSQYLGFGRDAWVYPDPARPGFARLRRQYLYSFYFSTLILTTVGDTPQPAR
EEEYLFMAGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQRVNRRLE
RRVIDWYQHLQINKKMTNEVAILEHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGVTQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPEELAEADDEGESGEETSKDEEGRAGQEGPPGPE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgagccaggacagcaaagtgaagacgacagagtccagccctcccgccccatccaaggcc
aggaaggcactgcctgttctggacccatctggggattactactactggtggctgaacacg
atggtcttcccagtaatgtataacctcgtcatcatcgtgtgcagagcctgctttcccgac
ttgcaacacgattatctggtggcctggttagtgctggactacacaagtgacctgctgtac
ctactggacatcgtggtgcgcttccacacgggattcctggaacagggcatcctggtggtg
gacaagggtaggatcgggcgtcgctacgttcgcacctggagcttctgcctggacctggcg
tcgctgctgcccacggacgcggcttacgcgcggctgggcccgcacacgcccacgctgcgg
ctgaaccgctttctgcgggctccccgcctcttcgaagcgtttgaccgcacggagacccgc
acggctcaccccaacgccttccgcatcgccaagctgatgctctacattttcgtggtcatc
cactggaacagctgcctctacttcgccctgtcccagtacctgggcttcgggcgggacgcc
tgggtgtacccggaccccgcgcggcccggcttcgcgcgcctgcggcgccagtacctctac
agcttctacttctccacgctgatcctgaccaccgtgggcgacacgccgcagcccgcgcgc
gaggaggagtacctcttcatggcgggcgacttcctgctggccgtcatggggttcgccacc
atcatggggagcatgagctctgtcatctacaacatgaacacggcggatgcggctttctac
ccggaccacgcgctggtgaagaagtacatgaagctgcagcgggtcaaccgccggctggag
cggcgcgtcattgactggtaccagcacctgcagatcaacaagaagatgaccaacgaggtc
gccatcttagagcacttgccagagcggttgcgggcagaagtggccgtgtctgtgcacctg
tctactctgagccgggtgcagatcttccagaactgtgaggccagcctgctggaggagctg
gtgctgaagctacagccccagacctactcaccaggcgaatatgtctgccgcaagggggac
attggccgagaaatgtacatcatccgcgagggtcagctggccgtggtcgcagacgatggt
gtcacacagtatgctgtgcttggtgcagggctctactttggggagatcagcatcatcaac
atcaaagggaatatgtctgggaaccgccgcacagccaacatcaagagtctgggttattcc
gacctgttttgcctgagcaaggaggacttgcgggaagtgctgagtgagtatccacaggcc
cagaccatcatggaggaaaagggccgggagatcctgctcaaaatgaacaagttggacgta
aacgctgaggcagctgagatcgccctacaggaggccacggagtcccggctgcgagggctc
gaccaacaactagatgatctacagaccaagtttgctcgcctcctggctgagctggagtcc
agtgcactcaagatcgcttatcgcatcgaacggctcgagtggcagactcgagagtggcca
atgcctgaggaactggccgaggccgatgatgaaggcgagtctggggaggaaacttccaag
gatgaggagggcagggctggacaggagggacccccaggcccagagtaa

DBGET integrated database retrieval system