KEGG   Miniopterus natalensis: 107532275
Entry
107532275         CDS       T05883                                 

Gene name
MRVI1
Definition
(RefSeq) protein MRVI1 isoform X1
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107532275 (MRVI1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107532275 (MRVI1)
SSDB
Motif
Pfam: MRVI1
Other DBs
NCBI-GeneID: 107532275
NCBI-ProteinID: XP_016062091
LinkDB
Position
Unknown
AA seq 916 aa
MTPGNGTQLGSGMGVDLTCPFDISSACGAQASWSIFWADTAEVPGTRGHSCQKAAMPHIP
EDEEPPGEPQAAQSPTGQGPPATGISCSPPTIILTGDASSLEGETDKNLANRAHSPHRRL
SHRHLKVSTAPLTSVDPAGHVIDLVNDKLPDISISEEDKKKNLALLEEAKLVSERFLARR
GRKSRSSPGDSPSAVSPNLSPGASPTPSRSNSLTIPTLPGLDTCSGSQSPLPGAPAQQKG
DEANVSSLHLGEPNIPKGLADRKQNDQRKVSQGRLTPRSPTVEKSKEIAIEQKENFDPLQ
CPEVAPKGPASGPGSVGKMALNSPQPGPAESELDKPLPKTAREGNPLPRSPAQSSGGSAP
LAPQGKGTAGEPVGSKVGFKAELRPPPSRPPLLRGVSWDSGPEEPGPRLQQVLAKLPLVE
EEKRFAGKASSKLAKVPGLKDLQIQVQPVRMQKLTKLREEHILMRNQNLVGLKLPELSEA
AEQEKGLPSELSPAMEEEEPKSGLDVMPNISDVLLRKLRVHKSLPGSAPPLTEKEVENVF
VQLSLAFRNDSYTLESRINQAERERNLTEEDTEKELENFKASITSSASLWHHCEHRETYQ
KLLEDIAVLHRLAARLSSRAEMVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEF
KKLANQNSSRSCGPSEDGVPRTARSMSLSLGKNMPRRRVSVAVVPKFNALSLPSQPPSSS
PIPSLPALSESPNGKGNLPVTTSALPALLENGKTNGDPDCEASAPTPTPSCPEEISQETK
AKMEEGTYNKRYQEDLKKTKELQGLKDDEEEQKNEGPEDPEGAEETEEEEKGPGSSKLEE
LVHFLQVLYPKLCQHWQVIWMMAAAMLVLTVVLGLYNSYNSCVEQTDGPLGRSTCSAAQR
DSWWSSGLQHEQPTEQ
NT seq 2751 nt   +upstreamnt  +downstreamnt
atgacccctggaaatggaacccagctcgggtcagggatgggagtggatttgacttgtcct
tttgacatctcctcagcctgcggagcccaggcctcttggagcatcttttgggctgacaca
gcagaggttccgggcacccgtggccactcctgccagaaggctgccatgccccacattccc
gaggacgaggagccccccggagagccacaggcagcccagagccccaccggccaaggccct
cccgccacaggaatatcttgcagtccacccaccatcatcctgactggggatgccagctca
ctggaaggagaaactgacaaaaacctggccaacagagctcacagtccccaccggaggctt
tctcaccgacacttgaaggtttccactgctccgctgacttctgtggaccctgcagggcat
gtcattgacctggtaaatgacaagctgccagacatcagcatctcagaggaggacaagaag
aaaaacctggcgctgctggaggaagccaagttggtgagtgagcggttcctggcccgccgt
gggaggaagtccaggagcagccccggagactccccatcagctgtttccccaaacctcagc
cccggagcttctcctacaccctctcggagcaactcactcaccatccccacgctgcctggt
ttggatacgtgcagtggttcgcagtcccctctgcccggagcaccagcacagcagaagggg
gatgaggccaacgtctcttcacttcacctcggcgagcctaatatccccaaagggctagct
gaccggaagcaaaatgaccagaggaaagtgtctcagggcaggctgactcctcgctctccc
acagttgagaagtccaaagagattgcaatagaacaaaaggaaaactttgaccccctccag
tgccctgaggtcgcacccaagggcccagcttctggcccaggcagtgtggggaaaatggct
ctgaacagcccccagcctggccctgctgagagtgagctggacaagccgctcccgaagaca
gccagggagggcaaccctctgcccagaagtccagcccagagctccggagggtcagctccc
ctggcaccccagggtaaaggcacagctggagagccagtagggtctaaggttggcttcaaa
gccgagcttcggccccctccttcccggccgcccctgctgcgaggggtctcctgggacagc
ggccctgaagaacctggcccccggctacagcaagtgcttgccaagctgcccctggttgag
gaagaaaagcgttttgcgggcaaagctagcagcaagctggccaaggtgcctggactcaaa
gaccttcagatacaagtgcagcccgtgcggatgcagaaactgaccaagcttcgtgaggag
cacatcttgatgagaaatcagaacttagtggggctcaagcttccagaacttagtgaagca
gcggagcaggaaaaagggctgccttctgaactctccccagctatggaggaggaggagcca
aagagtggcttggacgtcatgcccaatatttctgatgtgctgctgcgcaaactgcgggtc
cacaagtctctccctggaagtgcccctccactcactgaaaaggaagttgagaacgtgttt
gtacaactgtccttggcctttagaaatgacagctataccctggaatctagaattaaccag
gctgaaagggaacgcaacctgacagaagaggacaccgagaaggaactggaaaacttcaaa
gcttccatcacgtcttcagcttcactctggcaccactgtgagcaccgggagacctatcag
aagctgctggaggacatcgctgtcctgcaccgcctagctgcccgcctctccagccgggct
gagatggtgggggctgtccgccaggaaaagcgcatgtccaaggcaacagaggtgatgatg
caatacgtggagaacctgaagaggacatatgagaaggaccatgcggagctcatggaattt
aaaaaactggcgaatcagaattcaagccgcagctgcggcccctctgaagacggggtccct
cgcacagcgcggtccatgtccctctctctgggaaagaacatgccccgccggagggtgagc
gttgctgtggttcccaagtttaatgccctgagcctgcccagtcagcccccaagctcatca
cccatcccctccttaccagccctgtcagaatcacctaatggaaaaggcaatctacctgtc
accacctcagcactgcctgcacttttggaaaatggaaaaacaaatggggacccagattgt
gaagcctctgctcccacgccaactccgagctgcccggaggagattagccaggagacaaag
gccaagatggaagaaggaacgtacaataagagataccaggaagatctaaagaaaaccaaa
gagcttcaaggcctaaaagacgatgaggaagaacagaagaacgagggtcccgaggatcct
gaaggggccgaagaaactgaggaagaggaaaagggtccgggaagcagcaaacttgaagaa
ctggttcacttcttacaagtcctgtatcccaaactgtgtcagcactggcaagtcatttgg
atgatggctgcagcgatgctggtcttgactgtggtgttggggctgtacaattcctataac
tcttgtgtggagcagaccgacgggccccttggaagatccacttgctcggcagcccagagg
gactcctggtggagctcgggactccagcatgagcagcccacagagcagtag

DBGET integrated database retrieval system