KEGG   Miniopterus natalensis: 107532393
Entry
107532393         CDS       T05883                                 

Gene name
PGR
Definition
(RefSeq) progesterone receptor
  KO
K08556  progesterone receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107532393 (PGR)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107532393 (PGR)
   04914 Progesterone-mediated oocyte maturation
    107532393 (PGR)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    107532393 (PGR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107532393 (PGR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mna03310]
    107532393 (PGR)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107532393 (PGR)
Nuclear receptors [BR:mna03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107532393 (PGR)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107532393
NCBI-ProteinID: XP_016062210
LinkDB
Position
Unknown
AA seq 339 aa
MEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAV
ALPQPVGIPSESQALSQRITFSPTQDLQLVPSLINLLMSIEPDMVYAGYDNSKPDTSSAL
LTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGK
MLYFAPDLILNEQRMKELSFYSLCLTMWQIPQEFVKLQVSHEEFLCMKVLLLLNTIPLEG
LRSQNQFEEMRASYIRELIKAIGLRQKGVVSSSQRFYQLTKFLDNLHDLVKQLHLYCLNT
FIQSRALSVEFPEMMSEVIAAQLPKILAGMVKHLLFHKK
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaaggacagcataattatttatgtgctggaagaaatgactgcatcgtcgataaaatc
cgcagaaaaaactgcccagcctgtcgccttagaaagtgctgtcaggccggcatggtcctt
ggaggtcgaaagtttaaaaagttcaataaagtcagagttatgagagcactagatgctgtc
gctctcccacagccagtgggcattccaagcgaaagtcaagccctaagccagagaatcact
ttttcaccaacccaagatttacagttggtcccctcgctgatcaacctgctaatgagcatt
gaaccagacatggtctacgcaggatatgacaactccaaaccggacacctctagtgctttg
ctgacaagtcttaatcaactaggcgagagacaacttctttcagtagtcaagtggtctaaa
tcactgccaggttttagaaacttacacattgatgaccagataactctcatccagtattct
tggatgagcttaatggtgtttggactagggtggagatcctataaacatgtcagtgggaag
atgctgtattttgcacctgatctaatactaaatgaacagcggatgaaggaattatcattc
tattccttatgccttaccatgtggcagattccacaggagtttgtgaagcttcaagttagc
cacgaagagttcctctgtatgaaagtattgctacttcttaatacaattcctttggaagga
ctaagaagtcaaaaccagtttgaagaaatgcgagcaagctacattagagagctcatcaaa
gcaattggtttgaggcaaaaaggagttgtctctagttcacagcgtttctaccaacttaca
aagtttcttgataacttgcatgatcttgtcaaacaacttcatctgtactgcttgaataca
tttatccagtcccgggcactgagtgttgaatttccagaaatgatgtctgaagttattgct
gcacaattacccaaaatcttggcagggatggtgaaacatcttctctttcataaaaagtga

DBGET integrated database retrieval system