KEGG   Miniopterus natalensis: 107532399
Entry
107532399         CDS       T05883                                 

Gene name
TYR
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00350  Tyrosine metabolism
mna01100  Metabolic pathways
mna04916  Melanogenesis
Module
mna_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107532399 (TYR)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107532399 (TYR)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     107532399 (TYR)
SSDB
Motif
Pfam: Tyrosinase Laminin_EGF DUF2062
Other DBs
NCBI-GeneID: 107532399
NCBI-ProteinID: XP_016062216
LinkDB
Position
Unknown
AA seq 531 aa
MLPAVLYCLLWSFQTSHGHFPRGCVSSKNLMEKECCPPWRGDGSPCGQLSGRGSCQDIAL
SNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVR
RNIFDLSVPEKNKFLAYLNLAKRTTSPDYVIPTGTYGQMNNGSTPMFSDISIYDHFVWVH
YYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWERDIQELTGDENFTIPYWDWRD
AENCDICTDDYMGGHNPANPNLLSPASFFSSWQIICSRSEEYNSHQALCDGRPEGPLLRN
PGNHDKARTQRLPSSADVEFCLSLTQYESGTMDKTANFSFRNTLEGFASPLTGIANASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPAANAPIGH
NRESYMVPFIPLYRNGDFFISSRDLGYDYSYLQNSDPDFFRDYIKPYLEQASRIWPWLIG
AAVVGSVLTAVLGGLTGLVCRRRKRKQLSEEQQPLLMEKEDYHSMLYQSNL
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgctccctgctgtgttgtactgcctgctgtggagtttccagacctcccatggccatttc
cctcgaggctgtgtgtcctccaagaacctgatggagaaggaatgctgcccaccatggagg
ggcgacgggagtccctgtggccagctctcaggcaggggttcctgtcaggacattgctctg
tccaatgcaccacttgggccccaattccccttcacaggggtggatgaccgggagtcttgg
ccctctgtcttttataacaggacctgccagtgctctggtaacttcatgggattcaactgt
ggaaactgcaagtttggcttttggggaccaaattgcacagagaggcgacttttggtgaga
agaaacatcttcgatttgagtgttccagagaagaataaatttcttgcctacctcaattta
gcaaagcgtactaccagcccagactacgtcatccccacaggcacctatggccaaatgaat
aatgggtcaacacccatgtttagtgacatcagcatttacgaccactttgtctgggtgcac
tattatgtgtcgagggacacactgcttggggggtctgaaatctggagagacattgacttt
gctcatgaagccccaggtttcctgccctggcacagactcttcttgttgctgtgggaacga
gacatccaggagctgacaggagatgagaacttcaccatcccatactgggactggagagat
gctgaaaactgcgacatctgcacagatgactacatgggcgggcacaacccagcaaaccct
aaccttctcagcccagcgtccttcttctcctcttggcagatcatctgtagcagatcagag
gagtacaacagccatcaggctttatgcgatgggcgtcctgagggaccattactgcgcaac
cctggaaaccatgacaaagccaggacccagaggctcccctcctcagctgatgtggaattt
tgcctaagtttgacccagtatgaatccggtaccatggataaaactgccaacttcagcttt
aggaatacactggaaggatttgctagcccacttactgggatagcaaatgcctctcaaagc
agtatgcacaatgccttgcacatctacatgaatggaacgatgtctcaggtgcagggatct
gccaatgatcccattttccttcttcaccatgcatttgttgacagtatttttgaacagtgg
ctccgaaggcaccgtcctcttcaagaagtttatccagcagccaatgcacccattggacat
aaccgggaatcctacatggttcctttcatacctctctacagaaacggtgatttctttatt
tcatccagagacctgggctatgactatagctacctacaaaattcagatccagactttttt
cgagattacattaagccctatttagaacaagcaagtcggatctggccgtggctcattggg
gcagctgtagtggggtctgttctcactgccgtgctgggagggctcactggcctggtatgt
cgtcgtcggaagagaaagcagctgtccgaagaacagcagccactcctcatggaaaaggag
gattaccacagcatgttgtatcagagtaatttataa

DBGET integrated database retrieval system