KEGG   Miniopterus natalensis: 107532400
Entry
107532400         CDS       T05883                                 

Gene name
GRM5
Definition
(RefSeq) metabotropic glutamate receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04540  Gap junction
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna05010  Alzheimer disease
mna05016  Huntington disease
mna05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107532400 (GRM5)
   04072 Phospholipase D signaling pathway
    107532400 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107532400 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107532400 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107532400 (GRM5)
   04720 Long-term potentiation
    107532400 (GRM5)
   04723 Retrograde endocannabinoid signaling
    107532400 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107532400 (GRM5)
   05016 Huntington disease
    107532400 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    107532400 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107532400 (GRM5)
G protein-coupled receptors [BR:mna04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   107532400 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Peripla_BP_6 DUF5438
Other DBs
NCBI-GeneID: 107532400
NCBI-ProteinID: XP_016062217
LinkDB
Position
Unknown
AA seq 1007 aa
MVPLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINADPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLGRCADGAARSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKT
LFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIA
HSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLLLG
SDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLQLRPETNLRNPWFQEFWQHRF
QCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYA
GLCDAMKPIDGQKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDYIN
VGSWDNGELKMDDDEVWSKKSTIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV
SDEYTCRACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTAVFII
YRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALV
TKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDY
PSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCI
IWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVV
RMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGNGG
RATMSSSNGKSVTWAQNERSSRGQHLWQRLSIHINRKENPNQTAAAAGKPDLEELVALTP
PSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSSSSL
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggtccctctgttgatcttgtcagtgctgcttttgaaagaagatgtccgtgggagtgcg
cagtctagcgagaggagggtggtggctcacatgccgggtgacatcattattggagctctg
ttttctgtccaccaccagcccacggtggacaaagtccacgagaggaagtgtggggcggtc
cgcgaacagtatggcattcagagagtggaggccatgctgcacaccctggaaaggatcaac
gcggaccccacgctcctgcccaacatcaccctgggctgtgagatccgggattcctgctgg
cactcggccgtggccctggagcagagcatcgagttcatccgggactcgctcatctcctcg
gaggaggaggagggcctggggcgctgcgcagatggcgccgcccgctccaagaagcccatc
gtcggcgtcatcgggcccggctccagctccgtggccatccaggtccagaacttgctccag
cttttcaacatacctcagatcgcttactcggcaacaagcatggacctgagtgacaaaacc
ctgttcaagtacttcatgagggtcgtgccttcggatgcgcagcaggcccgggccatggtg
gacatagtgaagagatacaactggacctacgtgtcggccgtgcacacggaaggcaactac
ggagaaagtgggatggaagctttcaaagatatgtcggccaaggaaggaatttgcattgct
cactcttacaaaatctacagcaacgcaggagagcagagcttcgataagctgctgaagaag
ctcaggagtcacctgcccaaggccagggtggtagcctgcttctgtgagggcatgactgtg
cgaggactgttgatggccatgaggcgtctgggtctggctggagaatttctgcttctggga
agtgacggctgggctgacaggtatgacgtgacggatggctatcagcgagaagcggttggt
gggatcacaatcaagctccagtctcccgacgtcaagtggttcgatgattactatctgcag
ctccggccagaaacaaacctccgaaacccttggtttcaagagttttggcagcatcgtttc
cagtgccggctggaagggtttgcgcaggagaacagcaaatacaacaagacctgcaacagt
tctctgactctgagaacacatcacgttcaagattccaaaatgggatttgtgatcaatgca
atctactccatggcctatgggcttcacaacatgcagatgtccctctgcccaggctatgcg
ggcctctgcgatgcaatgaaacctattgatggacagaaacttttggactccctgatgaaa
accaactttactggggtttctggagatatgatcctattcgatgagaatggagactctcca
ggaaggtatgaaataatgaatttcaaggaaatgggaaaagattattttgattatatcaac
gttggaagctgggataatggagaattaaaaatggatgacgacgaagtatggtccaagaaa
agcaccatcatcagatccgtgtgcagcgagccgtgcgagaaaggccagataaaggtgatc
cggaagggagaggtgagctgctgttggacctgtacgccgtgcaaggagaatgagtatgtc
tcggacgagtacacctgcagggcgtgccagctgggctcctggcccacggacgacctcacc
ggttgtgacttgatcccagtccagtaccttcgctggggtgaccccgagcccattgcagct
gtggtgtttgcctgccttggcctgctggccaccctgttcgtcaccgcagtcttcatcatc
taccgtgacaccccggtagtcaagtcctccagcagggaactctgctacattatccttgct
ggcatctgcctgggctacttatgtaccttctgcctcattgcaaagcccaaacagatttat
tgctaccttcagagaatcggcattggtctctccccagccatgagctactcagccctcgtc
accaagaccaaccgtattgcaaggatcctggctggcagcaagaagaagatctgtaccaaa
aagccccgattcatgagtgcctgtgcccagctggtgattgctttcattctcatatgcatt
cagctgggcatcatcgtcgccctctttataatggagcctcctgacatcatgcacgactac
ccgagcatccgggaggtctacctgatttgcaacaccaccaacctgggagttgtcactcct
ctcggatacaacgggctgctgatcttgagctgtaccttctatgctttcaagacccggaac
gtcccggctaacttcaacgaggccaagtacatcgccttcaccatgtacaccacctgcatt
atatggctggccttcgtgccgatctactttggcagcaactacaaaatcatcaccatgtgt
ttctcggtcagcctcagtgccaccgtggcgctaggctgcatgtttgtgcccaaggtgtac
atcatcctggccaaaccggagaggaacgtgcgcagcgccttcaccacgtctacggtggtg
cgtatgcacgtgggggatggcaagtcatcctcggcagccagcaggtccagcagcctcgtc
aacctgtggaagaggagaggctcctctggggaaaccctcaggtacaaagacaggagactg
gcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatggggaatggtggg
agagcaacaatgagcagctccaacggcaagtcggtcacctgggcgcagaacgagaggagc
agccgcgggcagcacctgtggcagcggctgtccatccacatcaaccggaaggagaacccc
aaccagacggcggccgcggcgggcaagccggacctggaggagctggtggcgctcaccccg
ccgtcccccttcagagactcggtggactcggggagtaccacccccaactcgccggtgtcc
gaatctgccctctgtatcccctcgtctcccaaatacgacacgctgatcataagagattac
acccagagctcctcgtccttgtga

DBGET integrated database retrieval system