KEGG   Miniopterus natalensis: 107532511
Entry
107532511         CDS       T05883                                 

Gene name
EDNRA
Definition
(RefSeq) endothelin-1 receptor
  KO
K04197  endothelin receptor type A
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
mna04924  Renin secretion
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107532511 (EDNRA)
   04024 cAMP signaling pathway
    107532511 (EDNRA)
   04022 cGMP-PKG signaling pathway
    107532511 (EDNRA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107532511 (EDNRA)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107532511 (EDNRA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107532511 (EDNRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532511 (EDNRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107532511 (EDNRA)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Endothelin
    107532511 (EDNRA)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 107532511
NCBI-ProteinID: XP_016062376
LinkDB
Position
Unknown
AA seq 427 aa
METFCFRVSFWVALIGCVISDNPESYSTNLSTRVDDVTTFPGTELSFLVTTHRPTNLALP
SNGSMHSYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGIFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLITAIEIVSIWVLSFILAIPEAIGFVMVPFEYKGEQHKTCM
LNATSEFMEFYQNAKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDETDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHEQNNHNTERS
SHKDSIN
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccttttgcttcagggtgtccttttgggtagcgctgattggatgtgtaattagt
gataatcctgaaagctacagcacaaatctaagcactcgtgtggacgatgtgaccaccttt
cctgggacagagctcagcttcctggttaccactcatcgacccactaatttggccctaccc
agcaatggctcaatgcacagctattgcccacagcagactaagattacttcagctttcaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaagtgtatgaggaatggccccaacgcgctgatagcc
agccttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ctgctggctgggcgctggccttttgatcacaatgactttggcatatttctgtgcaagctg
ttcccctttttgcagaagtcttcagtggggatcactgtcctcaatctctgtgctctcagc
gttgacaggtacagagctgttgcttcctggagtcgtgttcagggaattgggattcccttg
atcaccgccattgagattgtctccatctgggtcctttcttttatcctggccatccctgaa
gcaattggcttcgtcatggtgccctttgagtacaagggtgaacagcacaaaacctgtatg
ctcaatgccacatcagagttcatggagttctaccaaaatgcaaaggactggtggctgttc
ggcttctatttctgcatgcccttggtgtgcaccgcaatcttctacaccctcatgacttgt
gagatgctaaacagaaggaatggcagcttgagaattgccctcagtgaacatcttaaacag
cgtcgagaggtggcgaaaacagtgttctgcttggttgtaatttttgctctttgctggttc
cctcttcatttaagtcgtattttgaagaaaaccgtgtatgacgagacggacaagaaccga
tgtgaattacttagtttcttgctgctcatggattacatcggtattaacttggcaactatg
aattcgtgtataaacccaatagctctctattttgtgagcaagaaatttaaaaattgtttt
cagtcttgcctctgctgctgctgttaccagtctaaaagtctgatgacctcggtccccatg
aatggaactagcatccagtggaaaaaccacgagcagaacaaccacaacacagagaggagc
agccacaaggacagtataaactaa

DBGET integrated database retrieval system