KEGG   Miniopterus natalensis: 107532649
Entry
107532649         CDS       T05883                                 

Gene name
SLC4A4
Definition
(RefSeq) electrogenic sodium bicarbonate cotransporter 1 isoform X1
  KO
K13575  solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
mna  Miniopterus natalensis
Pathway
mna04964  Proximal tubule bicarbonate reclamation
mna04972  Pancreatic secretion
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    107532649 (SLC4A4)
   04976 Bile secretion
    107532649 (SLC4A4)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107532649 (SLC4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107532649 (SLC4A4)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   107532649 (SLC4A4)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Fmp27_WPPW
Other DBs
NCBI-GeneID: 107532649
NCBI-ProteinID: XP_016062574
LinkDB
Position
Unknown
AA seq 1116 aa
MNNSLQVNLPRSWAASGGSLQEKSEHSFFLFYYYRMEDEAVLDRGASFLKHVCDEEEVEG
HHTIYIGVHVPKSYRRRRRHKRKTGHREKKERERVSENYSDKSDVENADESGSSILKPLI
SPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERW
SKPHVATLSLHSLFELRTCMEKGSIMLDREATSLPQLVEMIVDHQIETGLLKPDLKDKVT
YTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFASPDNGSPAMTHRNLTSASLNDISDKP
EKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFVAFVRLQQAVMLGALTEVPVPTRFLF
ILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEW
DPAIRIEPPKSLPSSDKRKNMYSGGENVSQMNGDTPHDGGHGGGGGHGDSEELQRTGRFC
GGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLE
SFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDNNFDYLEFRLWIGLWSAF
LCFILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMVKLADYYPINADFRVGYNT
LFSCACLPPDPVNISMSNGTTLAPEDFPTVSPTDMDHNATLDWAALSKKECLKYGGSLVG
NNCEAVPDITLMSFILFLGTYTTSMALKKFKTSRYFPTMARKLISDFAIILSILIFCVID
ALVGVDTPKLIVPSEFKPTSPHRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITA
VIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSA
PGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFM
DRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILAL
VAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKRKKKKKGSLDSDNDDSDCPYSEKVP
SIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC
NT seq 3351 nt   +upstreamnt  +downstreamnt
atgaacaacagcctgcaggtcaacctgcccagaagctgggctgcttcaggtggctcactc
caggagaagtctgagcactctttttttcttttttattactataggatggaagatgaagct
gtcctggacagaggggcttccttccttaagcatgtgtgtgacgaagaagaagtggaaggc
caccacaccatctacattggggtccacgtgccgaagagctaccggagaaggagacgtcac
aagagaaagacagggcacagagagaagaaggaaagggagagagtctctgagaactactcc
gacaagtccgacgtggaaaacgccgatgaatccggcagcagcatcctaaagccgctcatc
tccccggccgccgagcgcatccgcttcatcctgggcgaggaggatgacagcccggcgccc
ccccagctcttcaccgaactggacgagctgctggccgtggacgggcaggagatggagtgg
aaggagacggcgaggtggattaagtttgaagaaaaagtggaacagggtggagagagatgg
agcaagccccatgtggccacgctatcccttcacagcttatttgagctgaggacctgtatg
gagaaagggtccatcatgcttgacagggaggctacttctctgccacagttggtggagatg
attgttgaccatcagatcgagacaggtcttttgaaacctgaccttaaggataaggtgacc
tacactttgctccggaagcatcggcatcaaaccaagaaatccaaccttcgatccctggct
gacattgggaagacagtttccagtgcaagtaggatgttcgccagccctgataatggtagc
ccagccatgacccacaggaatctgacttcggccagcctgaacgacatttctgataaaccg
gagaaggaccagctgaagaacaagttcatgaaaaagctgccccgcgatgcagaagcctcc
aacgtgctcgtcggcgaggtggacttcttggacacgcctttcgttgcctttgttcggctg
cagcaggcggtcatgctgggggccctgactgaggtccccgtgcccacaaggttcttgttc
attctcctaggtcctaaggggaaggccaagtcctaccatgagattggcagagccatcgcc
accttgatgtctgacgaggtgttccatgacattgcttataaagcaaaagataggcaggac
ctgattgccggcatcgatgagttcctagatgaagtcatcgtccttccccctggggaatgg
gatccagccatcaggatagagcctcctaagagccttccatcgtctgacaaaagaaagaac
atgtactcaggtggagagaatgtttcccagatgaacggggacacaccccacgatggcggc
cacggcggcggcggaggtcacggggacagtgaagaattgcagaggactggacggttctgt
ggtggactaattaaggacataaagaggaaagcaccattttttgccagtgatttttatgac
gctttaaatattcaagctctgtcagcaattctcttcatttatctggcgactgtcactaac
gctatcacttttggaggactgcttggggatgccactgacaacatgcagggtgtgctggag
agcttcctgggcacggctgtctctggagccatcttctgcctctttgctggtcagccactc
actattctgagcagcacaggacctgttctagtttttgagaggcttctatttaatttcagc
aaggacaataattttgactatttggagttccgcctttggattggcctgtggtcagccttc
ctgtgcttcattttggtagccaccgatgccagcttcctggttcagtactttacccgcttc
accgaagagggcttctcttctctgattagcttcatctttatctacgatgctttcaagaag
atggtcaagctcgccgattactaccccattaatgctgacttcagagtgggctacaatact
ctcttttcctgtgcctgtctgccgcctgacccagttaatatctcgatgtctaatggcacc
acattggctcccgaggattttccaactgtgtctcctactgacatggaccacaacgccacc
ttggactgggcggccctgtcgaagaaggagtgtctgaaatacggaggaagcctggtggga
aacaactgcgaggccgtccctgacatcacgctcatgtcgttcattctcttcttgggcacc
tacaccacctccatggctctcaagaaattcaagaccagtcgctattttccaaccatggca
agaaaactgatcagcgattttgccatcatcttgtccattctcatcttttgcgtaatagat
gccctggtaggcgtggatactccaaagctaatcgtgccaagcgagttcaagcccacgagc
ccgcaccgcggctggttcgtggcgcccttcggaggcaacccctggtgggtgtacctggcg
gccgccatccccgcgctgctggtcaccatcctgatcttcatggaccagcagatcaccgcc
gtgattgtgaacaggaaggagcataagctcaagaaaggggctggctatcacctggatctc
ttttgggtggccatcctcatggtggtgtgctccttcatggctctcccctggtatgtggct
gctactgtcatctccatcgctcacatcgacagtttgaagatggagacggagacttctgca
cctggagagcagccaaagtttctcggggtgagggaacaaagagtcactggaacgcttgtg
tttattctgactggcctgtcagtctttatggctcccatcttgaagtttattcccatgcct
gtactctatggcgtgttcctgtatatgggggtagcatcccttaatggggtccagttcatg
gaccgtctgaagctgctcctgatgcctctgaagcatcagcctgacttcatctacctgcgc
cacgtccccctgcgcagggtccacctgttcactttcctgcaagtgttgtgtctagccctg
ctctggatcctcaagtcaaccgtggctgctatcatttttccagtcatgatcttggcgctt
gtagctgtcagaaaaggcatggactacctcttctcccagcacgacctcagcttcctcgac
gatgtcattccagaaaaagacaagaaaaagaaggaagatgagaagagaaagaaaaagaag
aaaggcagcctggacagcgacaatgatgactctgactgcccatactcagaaaaagttcca
agtattaaaattccaatggacatcatggaacagcaacctttcctaagtgatagcaaacct
tccgacagagaaagatcaccaacattccttgaacgccacacatcatgctga

DBGET integrated database retrieval system