KEGG   Miniopterus natalensis: 107532710
Entry
107532710         CDS       T05883                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04072  Phospholipase D signaling pathway
mna04144  Endocytosis
mna04151  PI3K-Akt signaling pathway
mna04510  Focal adhesion
mna04540  Gap junction
mna04630  JAK-STAT signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05230  Central carbon metabolism in cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107532710 (PDGFRA)
   04014 Ras signaling pathway
    107532710 (PDGFRA)
   04015 Rap1 signaling pathway
    107532710 (PDGFRA)
   04630 JAK-STAT signaling pathway
    107532710 (PDGFRA)
   04020 Calcium signaling pathway
    107532710 (PDGFRA)
   04072 Phospholipase D signaling pathway
    107532710 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    107532710 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107532710 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107532710 (PDGFRA)
   04540 Gap junction
    107532710 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107532710 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107532710 (PDGFRA)
   05206 MicroRNAs in cancer
    107532710 (PDGFRA)
   05230 Central carbon metabolism in cancer
    107532710 (PDGFRA)
   05231 Choline metabolism in cancer
    107532710 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    107532710 (PDGFRA)
   05218 Melanoma
    107532710 (PDGFRA)
   05215 Prostate cancer
    107532710 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107532710 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107532710 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107532710 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107532710 (PDGFRA)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107532710 (PDGFRA)
Protein kinases [BR:mna01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107532710 (PDGFRA)
CD molecules [BR:mna04090]
 Proteins
  107532710 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like DUF3475
Other DBs
NCBI-GeneID: 107532710
NCBI-ProteinID: XP_016062673
LinkDB
Position
Unknown
AA seq 1102 aa
MTRKAETLFQFSRAMGTSHLALLVLGCLLAGPRRGLCQLPLPSILPNENEKVVQLNSSFS
LRCFGESEVTWQYPMSDEDPNVKIRSEENNSGLFVTVLEVANASAAHTGLYTCYYNHTQT
KDSEVEGSHIYIYVPDPDVAFVPLGMTDYLVIVENDDFAVIPCRTTDPQTPVTLLSSDGV
VLADYDSRQGFNGTFTGGPYICEAIVRGKKFQTIPFNIYAVTATSELDLELEAPKTVYKS
GETIVLNCIVFNNEVVDLRWTYPGEVKNKGVIMLEEIKDPSIKLVYTLMVPKATVKDSGD
YECVARLTTREVKEMKKVTISVHEKGFIEIQPSFSQLEAVNLHEVKHFVVDVQAYPPPRI
SWLKDNLTLIENLTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDMKTYTF
ELLTQVPSSIVDLVDDHHGSSGGQTVRCTAAGTPLPDIEWLICKDIKRCNNETSWATLAN
NISNIITEVYALDRSMVEGRVTFAKVEETIAVRCLAKNLLGVENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKTKKELDI
FGLNPADESTRSYVVLSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSVLDSEVKDLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEIYEIMVKCWNSEPEKRPSFYHLR
EIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgactcggaaggcagaaactttgttccagttttccagagctatggggacttcccatctg
gcactcctggtcctaggctgtctcctcgcagggccccggcgaggcctctgccagctccct
ctgccctccatcctcccaaacgagaacgagaaggtcgtgcagctgaactcgtcgttctct
ctgagatgcttcggggagagcgaagtgacctggcagtaccccatgtcggacgaggacccc
aatgtgaagatcaggagcgaggagaacaacagcggcctttttgtgacggtgctggaggtg
gccaacgcctcggcggcccacacgggcctgtacacctgctattacaaccacacgcagacc
aaggacagcgaggtcgaaggcagccacatttacatctacgtgccagacccggatgtagcc
tttgtgcctctaggaatgactgattacttggtcatcgtggagaacgatgattttgctgtt
ataccttgccgcacgactgacccgcagactccggtgaccttgctgagcagtgatggggtg
gtcctggctgactatgacagcagacagggcttcaacgggaccttcactggtgggccctat
atctgtgaggccatcgtcagagggaagaagttccagaccattccatttaacatttatgct
gtaacagcaacatcagaacttgatctagaactggaagctcctaaaactgtatataagtcg
ggggaaacaattgtgctcaactgcatcgtctttaacaatgaggtggttgaccttcggtgg
acttaccctggagaagtgaaaaacaaaggcgtcataatgctggaggaaatcaaggaccca
tccatcaaattggtgtacaccctgatggtccccaaggccacggtgaaagacagtggagat
tacgaatgcgttgcccgcctgaccaccagggaggtcaaagaaatgaagaaagtcaccatt
tctgtccatgagaaagggttcattgaaatccaacccagcttcagccagttggaagctgtc
aacctgcatgaagtcaaacattttgtggtggatgtgcaggcctaccccccgccccggata
tcctggctcaaggacaacctgaccctcatcgaaaacctcaccgagatcaccaccgacata
gaaaagatccaggagataaggtaccgaagcaaattgaagctgatccgtgctaaggaagaa
gacagtggccattacactatcgtagttcaaaacgaagatgacatgaagacctacactttc
gaactcttaactcaagttccctcatctattgtggacttggtggacgaccaccacggctct
tcagggggacagactgtgaggtgcacagcggcagggacgcctctccctgacattgagtgg
ttgatctgtaaggacattaagagatgtaataatgagacttcgtgggcaactctggccaac
aacatctcaaacatcatcacggaggtctacgccctagacaggagtatggtggagggccgg
gtgacattcgccaaagtagaggagaccattgcagttcgatgtctggctaagaatctcctt
ggggttgagaatcgagagctaaagctggtggctcccactctgcgctctgagctcacggtg
gcagccgcagtcctggtgctgttggtgattgtgatcatctcactgattgtcctggttgtc
atttggaaacagaaaccaaggtatgaaattcgctggagggtcattgaatctatcagcccc
gatggacatgaatatatttatgtggacccgatgcagctgccttatgactcgagatgggag
tttccaagagatggactagtgctgggtcgaatcctgggatctggtgcgtttggtaaagtg
gttgaaggaactgcctatggattaagccggtcccaacctgtcatgaaagtagcagtgaag
atgcttaaacccacagccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgacccacctggggccacatttaaacattgtcaacttgctgggagcctgtaccaagtca
ggccccatttacatcatcaccgagtactgcttctatggggatttggtcaactatttgcat
aagaatagggacagcttcctgagccaccacccagagaagacaaagaaagagctggacatc
tttggattgaaccctgctgatgaaagcacacggagttatgttgttttatcttttgaaaac
aatggtgactacatggacatgaagcaagctgacaccacacagtacgtccccatgctggaa
agaaaagaagtttctaaatactcggacatccagaggtccctgtatgaccgcccagcctcg
tacaagaagaagtctgtgttagactcagaagtcaaagacctcctttcggatgataactcg
gaaggcttgactctgttggatttgttgagcttcacctatcaagttgcccgaggaatggag
tttttggcttcaaaaaattgtgtccaccgggacctggccgctcgcaacgtcctcctggca
caaggaaaaatcgtgaagatctgtgactttggcctggccagagacatcatgcatgattcg
aactacgtatcaaaaggcagcaccttcctccccgtgaagtggatggctcctgagagcatc
ttcgacaacctctacaccacgctgagtgatgtctggtcttacggcattctgctctgggag
atcttttccctcggtggcacaccctaccctggcatgatggtggattctactttctacaat
aagatcaagagtgggtaccggatggccaagccagaccacgccaccagtgaaatctacgag
atcatggtgaagtgctggaacagcgagccagagaagagaccctccttttaccatctgaga
gagattgtggagaacctgctgcctggacagtataaaaagagttatgaaaagattcacctg
gatttcctgaagagcgaccatcccgccgtggcacgcatgcgagtggatgctgataatgcc
tacattggcgtcacctacaaaaatgaagaggacaagctgaaggactgggagggtggcctg
gatgagcagaggctgagtgctgacagcggctacatcattcctctgcctgacattgaccct
gttcctgaggaggaagacctgggcaagaggaacagacacagctcgcagacatctgaagag
agtgccattgagacaggttccagcagttctaccttcatcaagagagaagacgagaccatt
gaggacatcgacatgatggatgacattggcatagactcctcagacctggtggaggacagc
ttcctttaa

DBGET integrated database retrieval system