KEGG   Miniopterus natalensis: 107532766
Entry
107532766         CDS       T05883                                 

Gene name
ATP7A
Definition
(RefSeq) copper-transporting ATPase 1
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    107532766 (ATP7A)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107532766 (ATP7A)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     107532766 (ATP7A)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 Hydrolase_6 HAD_2
Other DBs
NCBI-GeneID: 107532766
NCBI-ProteinID: XP_016062749
LinkDB
Position
Unknown
AA seq 1505 aa
MDPSMGVNSVTISVEGMTCSSCVWTIEQQIGKLNGVHHIKVSLEEKTATIIYDPKLQTPK
TLKEAIDDMGFDAILHNPNPLPVLTDTVFLSVIASLTPPWDHIQSTLLKTKGVTDIKISP
QQRTAVVTIIPSLVNANQIIELVPDLSLDTGGLEKKSGTCEDYSTTQAGEVMLKMKVEGM
TCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLITTEEIKKQIEAVGFPAFIKK
QPKYLSLGSIDIERLKNTPVKSSEGSQQRSPSCTNDSTVTFIIDGMHCKSCMSNIENALS
TLQYVSSVVVSLENRSAVVKYNASLVTPETLKKAIEAISPGQYRVSISSRVESTSNSPSS
SSLQKIPLNIGMGQPLTQETVINIDGMTCNSCVQSIEGVISKKAGVKSILVSLANANGTV
EYDPLLTSPETLRKAIEDMGFDATLPGTNEPLVVIAQPSSEMPHLTSANEFYVKMMTPVH
NKEEAKTSSKCYIQVTGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQP
PMIAEFIRELGFGATVIENADEGDGVLELIVRGMTCASCVHKIESTLTKHRGIFYCSVAL
ATNKAHVKYDPEIIGPRDIIHTIESLGFEASLVKKDRSASHLDHKREIRQWRRSFLVSLF
FCIPVMGLMIYMMVMDHHLATLHHRQNMSQEEMVNIHSSMFLERQILPGLSVMNLLSFLF
CVPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMYERARVNPIT
FFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDV
ELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKYGSTVIAGSINQNGS
LLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVIISIVTLLVWIII
GFLNFQVVKTYFPGYSRSISQTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVG
AQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVSQVKILVESNRMSRNKILAIVGT
AESNSEHPLGAAVTKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWKIEE
DNIKNASLVQIDASNEQSSTSMIIDARLSNAFLYSDALNAQQYKVLIGNREWMTRNGLVI
NNDIHDSMTEHERKGRTAVLVAVDDVLCGLIAIADTVKPEAELAVHILKAMGLEVVLMTG
DNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVG
IAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAG
VFMPIGLALQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYENYELHSRSQMGQKSPSEIS
VHVGIDDTSRSSPKLGLLDRIVNYSRASINSLLSDKRSLNSVGISEPDKHSLLVGDCRED
EDTTV
NT seq 4518 nt   +upstreamnt  +downstreamnt
atggatccaagcatgggtgtgaattctgtcaccatctctgttgaggggatgacgtgtagt
tcctgtgtttggaccattgaacagcagattggaaaactgaatggtgtacatcacattaaa
gtttcactggaagaaaaaactgcaactattatttatgaccctaaactacagactcctaag
accctaaaggaagctattgatgacatgggctttgatgctattctccacaatcctaaccct
ctccctgttttaactgacactgtgtttctgagtgtcattgcttcactgactccgccatgg
gaccatatccaaagtacattgctcaagaccaagggtgtcacagatattaaaatttcccct
cagcaaagaactgcagtggtgacaataatcccttctttagtgaatgccaatcagataata
gagctggttccagatctcagtttagatactggaggtctggagaaaaagtcaggaacttgt
gaagattacagtacaactcaagcaggtgaagtcatgctgaagatgaaagtggaagggatg
acctgccattcatgcactagcaccattgaaggaaaaatagggaaactgcaaggtgtccag
cgaattaaagtctccctggacaaccaagaagctactattgtttatcaacctcatcttatc
acaacagaggaaataaaaaagcagattgaagctgtgggctttccagcattcatcaaaaaa
cagcccaagtacctcagcttgggaagtattgatatagaacgtctaaaaaacacaccagtc
aaatcttcagagggatcacagcaaaggagtccatcatgtaccaatgactccacagttact
ttcatcatagatggcatgcattgtaaatcatgtatgtcaaatattgaaaatgctttatct
acactccaatatgtaagcagcgtagtagtttctttagagaatagatctgctgtagtaaag
tacaatgcaagcttagtcactccagaaaccttgaaaaaagcaatagaggccatatcacca
ggacaatatagagttagtatttcaagtagagttgagagtacttcaaactccccctccagc
tcatctcttcaaaagattcctttgaacataggaatgggccagcctctgacccaagaaacc
gtgataaacattgatggcatgacttgtaattcttgtgtgcagtctattgagggtgtcata
tcaaaaaaggcaggtgtaaaatccatactagtatcccttgcgaatgccaatggaactgtt
gaatatgatcctctactaacctctccggaaactttgagaaaagcaatagaagacatggga
tttgatgctaccttgccaggtacaaatgagccattggtagtaatagctcagccctcatca
gaaatgccacacttgacctcagctaatgaattttatgtgaaaatgatgacaccagttcac
aacaaggaggaggcaaagacttcatctaagtgttacatacaggtcaccggtatgacttgt
gcttcctgtgtagcaaacattgaacggaatttaagacgagaagaaggaatatattctgta
cttgtggctctgatggctggcaaagcagaagtaagatataatcctgctgttatacaaccc
ccaatgatagccgagtttatccgagagcttggatttggcgccactgtgatagaaaatgct
gatgaaggggatggagttttggaacttattgtgagaggaatgacctgtgcctcctgtgta
cataaaatagagtctaccctcacaaagcacagaggtattttctactgctctgtggccctg
gcaaccaacaaagcacatgttaaatatgatccagaaattattggtcccagagatattatc
catacaattgaaagcttaggttttgaggcttctttggtcaagaaggatcggtcagcaagc
cacctagaccacaaacgagaaataagacaatggagacggtccttcctcgtgagcctcttt
ttctgtattcctgtaatgggactgatgatatatatgatggttatggaccaccaccttgca
actcttcaccataggcagaacatgagtcaagaagaaatggtcaacattcattcttctatg
ttcctagagcgccagatcctgccaggattgtccgttatgaatttgctatcctttttattt
tgcgtaccagtacagttttttggaggctggtacttctacattcaggcctacaaagcactg
aagcataaaactgcgaatatggacgtactgattgtgctggccaccaccattgcatttgct
tactctttggttattcttctggtcgcaatgtatgagagagccagagtgaaccctattact
ttctttgacacacctcctatgctatttgtgtttattgcactaggccggtggctggagcat
atagcaaagggcaaaacgtcagaggctcttgccaagctaatttcactacaagctacagaa
gcaactattgtaactcttgattctgataatatcctcttgagtgaagaacaagtggatgtg
gaacttgtgcagcgtggagacatcattaaagtagttccaggaggcaaatttccggtggat
ggtcgtgttattgaaggacattctatggtagatgagtccctcatcacaggggaggcaatg
cctgtggctaagaaatatggcagcacagtgattgctgggtccattaaccagaatgggtca
ctactcatccgtgcaacccatgttggagcagacacaaccctttctcaaattgtcaaactt
gtggaagaggcacaaacatcaaaggctcctatccagcaatttgcagacaaactcagtggc
tactttgttccttttattgttattatttccattgttaccctcttggtttggattataatt
ggatttctgaatttccaagttgtgaaaacctactttcctggctacagcagaagtatctcc
caaacagaaacgataatacgctttgctttccaagcctctatcacagttctgtgcattgca
tgtccctgttcactgggtctggcgactccaactgctgtgatggtgggtacaggagtaggc
gctcaaaatggcatactaatcaaaggtggcgagccattggagatggctcataaggtaaag
gtagtggtatttgataagactggaaccattacccatggaaccccagtagtgagtcaagta
aagattctagtggaaagtaacagaatgtcacgcaataagatcctggccattgtgggaact
gctgaaagtaacagtgaacaccctctaggagcagctgtaaccaaatactgcaagcaggag
ctggacactgaaaccttgggtacttgcatagatttccaggttgtgccaggctgtggtatt
agctgtaaagtcaccaatattgaaggcttattacataagaataactggaagatagaggaa
gataatattaaaaatgcgtccctggttcagattgatgccagtaatgaacagtcatcaact
tccatgattattgatgcccggctctcaaatgcttttttatactcagatgctcttaatgct
cagcagtacaaagtcctcattggtaaccgggagtggatgactagaaatggtcttgtcatt
aataatgatatacatgattccatgactgaacatgagagaaaaggtcgtactgctgtattg
gtggcagttgatgatgtgctgtgtggcttgatagctattgccgatacagtgaagcctgaa
gcagaattggctgtccatattctgaaagctatgggcttagaagtagttctgatgactgga
gacaacagtaaaacagctagatctattgcttctcaggttggcattactaaggtgttcgct
gaagttctaccttcccacaaggttgctaaggtgaagcaacttcaagaggaggggaaacgg
gtagcaatggtaggagatggaatcaatgactccccagctctggcaatggccaatgttgga
attgctattggcacaggcacagatgtagccattgaagcagctgatgtggttttgataagg
aatgatcttctggatgtagtggcaagtattgatttatcaaggaagacagtcaagagaatt
cggataaattttgtcttcgctctaatttataatctggttggaattcccatagctgctgga
gtgtttatgcccattggtttggctttgcagccttggatgggatctgctgcaatggctgct
tcatctgtttcagtagtactttcctctctcttccttaaactttataggaaaccaacttat
gagaattacgaactgcattcccgaagccagatgggacagaaaagtccttcagaaatcagc
gttcatgtcggaatagatgacacctcaagaagttctcctaaactgggtttgctggaccgg
attgttaattacagcagagcctccataaactcactactgtctgataaacggtccctaaat
agcgttggtatcagtgaacctgacaagcactcactcctggtgggggactgtagggaagat
gaggacactacagtgtaa

KEGG   Miniopterus natalensis: 107537556
Entry
107537556         CDS       T05883                                 

Gene name
ATP7B
Definition
(RefSeq) copper-transporting ATPase 2
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    107537556 (ATP7B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107537556 (ATP7B)
Enzymes [BR:mna01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     107537556 (ATP7B)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 HAD_2 HAD Hydrolase_6
Other DBs
NCBI-GeneID: 107537556
NCBI-ProteinID: XP_016069075
LinkDB
Position
Unknown
AA seq 1464 aa
MMPEQEERQITAREGASRKVLSKLSLPACGWEPAMKQSFAFDNVGYEGSLDSVCPSQTTT
GTISILGMTCQSCVKSIEGRISSLKGIVSVKVSLEQSSAAVKYVPSVISLPQVCRQIEDM
GFEASIAEGKAGSWPLRSSQALEAVVKLRVEGMTCQSCVSSIEGKIGKLQGVVRVRVSLS
NQEAVITYQPYLIEPQDLRDHVNDMGFEAVIKNKVAPVSLGQIDIGQLQSTSSKTPSASN
QNVNNSQALGHQGRHVVTLQLRIGGMHCKSCVQNIEGNISQLPGVQNIQVSLENRTAQIQ
YHPSYISPGALQKAIEALPPGNFKVSLPDGAEGSGTDNRSSTRHSPALTQRTQVQGSCCT
MVLAIAGMTCASCVQSIEGLISQRKGVQQVSVSLADGTGTILYDPSVINPEELRAAVEDM
GFEVSVVSGSCSGNHVGEHSVVNSTVQTTVGTPVSAQKVAHHAGGPPKIHSPDLSVKSLQ
ASATVAPQKCFLQITGMTCASCVSNIERNLQKEAGILSVLVALMAGKAEIKYNPEVIQPL
EIAQLIHNLGFGATVMEDYTGSDGDIELIITGMTCASCVHNIESKLTRTNGITHASVALA
TSKAHVKFDPEIIGPRDIVKIIEEIGFHASLAQRNPNAHHLDYKVEIKQWKKSFLSSLVF
GIPVMGLMIYMLIPSNKPHKSMALDHNIIPGLSILNLIFFILCTFVQFLGGWYFYVQAYK
ALRHRAANMDVLIVLATSIAYVYSLVILVVAIAEKAERSPVTFFDTPPMLFVFIALGRWL
EHVAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDVIKVVPGGKFP
VDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLVNATHVGNDTTLAQIV
KLVEEAQMSKAPIQQLADKFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPTPNKH
ISQAEVTIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAARNGILIKGGKPLEMAHK
IKTVMFDKTGTITHGVPKVMRFLLLMDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCK
EELGTEALGYCMDFQAVPGCGIGCKVTSVEGILAHSGHLNEQATHLNGVGSVPSEIDVAP
QTFSVLIGNREWMRRNGLAISSDISDAMTDHEMKGQTAILVAIDGLLCGMIAIADAVKQE
AALAVHTLKSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQKEGKK
VAMVGDGINDSPALTQADIGIAIGTGTDVAIEAADVVLIRNDLLDVVAGIHLSKRTVWRI
RLNLVLALIYNLVGIPIAAGVFMPLGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDL
ESYEAQAQGHMKPLTESQVSVHIGMDDRRWDPPRATPWDQVSYISQVSLSSLKSDKLSWQ
SATADDSGDKWSLLLNDRDEEQCI
NT seq 4395 nt   +upstreamnt  +downstreamnt
atgatgcctgaacaggaggagagacagatcacagctcgagaaggggccagtaggaaagtt
ctatctaaactttctttgcccgcttgtggctgggaaccagcaatgaagcagagtttcgct
tttgacaatgttggctacgaaggtagtctggacagtgtgtgcccttcacagacaaccacc
ggcaccatcagcattttgggcatgacttgccagtcatgtgtaaaatctattgagggcagg
atttccagtttgaaaggcattgtgagtgttaaggtttccctggaacaaagcagtgcagct
gtgaaatatgtgccatcggttataagcctgccacaggtttgccgtcaaattgaggacatg
ggcttcgaggccagcattgcagaaggaaaagctggttcctggcctttaaggtcctcgcaa
gccctggaggctgtggtcaagcttcgggtggagggcatgacctgccagtcctgtgtcagc
tccatagaaggcaagattgggaagctgcaaggagtagtgagagtcagagtctcactcagc
aaccaagaggcagtcatcacttatcagccttatcttattgaaccccaagacctcagagac
catgtcaacgacatgggttttgaagctgtcatcaagaacaaagtggctcctgtaagcctg
ggacaaattgatattgggcaattacagagcaccagctcaaagacaccttcagcttctaat
cagaatgtcaataactctcaggccttggggcaccaagggcgccatgtggtcaccctgcaa
ctgagaataggtggaatgcattgtaagtcttgtgtccagaatattgaaggaaatatcagc
caactcccaggggttcaaaatattcaggtgtccttggagaacagaactgcccaaatacag
taccacccttcttacatctccccaggggccctgcaaaaggccattgaggctcttccacca
gggaactttaaagtttctcttcctgatggagcagaaggaagtgggacagataacagatct
tctacacgtcactctcctgccctcacccagagaacccaggtgcaaggctcgtgctgtacc
atggtgcttgctattgctggcatgacctgtgcatcctgtgtccagtccatcgaaggcctg
atctcccaaaggaaaggcgtgcagcaagtatcagtctctctggctgacgggactggaaca
attctctatgatccctctgtaattaacccagaagaactccgggctgctgtagaagacatg
ggatttgaggtttcggtcgtttctggaagctgttctggcaaccatgttggagagcacagt
gtggtgaattccacagtgcaaactacagttggcacacctgtgtctgcacagaaagtggct
caccacgctggggggccacctaaaatccacagccctgacctctcagtgaagtccctgcaa
gcctccgcaacagtggccccacagaagtgctttttacagatcacaggcatgacctgtgca
tcctgtgtgtctaacatagagagaaacctgcagaaagaagctggtattctctctgtgctg
gttgctttgatggccggaaaggcagagattaaatacaatccagaagtcatccagccactc
gagatagctcagctcatccacaacttgggctttggggcaacagtaatggaagactacaca
ggctcagatggcgacattgagctgatcataaccgggatgacttgtgcttcctgtgttcac
aacatagagtccaaactcacgaggacgaatggcatcacccacgcctccgtggcgcttgca
accagcaaagcccatgtgaagtttgaccctgaaattattggtccacgggatattgtcaaa
attattgaggaaatcggctttcatgcttccctggcccagagaaaccccaacgctcatcac
ttggactacaaggtggaaataaagcagtggaagaagtctttcctgtccagcctcgtgttt
ggcatccctgttatgggcttaatgatctatatgttgatacccagcaataaaccccacaaa
tctatggccctagaccacaacatcattccaggattgtccattctaaatctcatcttcttt
atcttgtgtacctttgtccagttccttggtgggtggtacttctatgttcaggcctacaaa
gctctaagacacagggcagccaacatggatgtgctcatcgtgctggccacgagcatcgcc
tatgtctactccctggtcatcctggtggtggccattgctgagaaggccgagaggagcccc
gtgacattctttgataccccccccatgctctttgtgttcattgccctggggcggtggctg
gaacacgtggcaaagagcaaaacctcagaagcccttgccaaactcatgtctctccaagcc
acagaagccaccgtcgtgacccttggtgaggacaacttaatcatcagagaggagcaagta
cccatggagctggtgcagcggggtgatgtcattaaggttgttccagggggaaagttccca
gtggatggcaaagtcctagaaggcaataccatggccgacgagtccctcatcacaggagaa
gccatgccagtcactaagaaacccgggagcatagtgattgctgggtctataaacgcacat
ggctctgtgctcgttaatgctacccatgtgggcaatgacaccactttggctcagattgtg
aaattggtggaagaggctcagatgtcaaaggcacccattcagcaactggctgacaagttt
agtggatactttgtcccatttatcatcatcatttcaactttgacgttggtggtatggatt
ataatcggttttatcgattttggtgttgtgcagaaatactttcctacccccaacaagcat
atctcccaggcagaggtgaccatccggtttgcattccagacgtccatcacagtgctgtgc
attgcctgcccctgctctctaggcttggccacacccacggcggtcatggtgggcaccggc
gtggctgcccggaacggcatcctcatcaaggggggcaaacctctggagatggcccacaag
ataaagactgtgatgtttgacaaaactggcaccattacccatggggtccccaaagtcatg
cggttcctcttgctcatggatgtggctacactgcccctcaggaaggttcttgctgtggtg
gggactgcggaggccagcagcgagcaccccttgggtgtggctgtcaccaaatactgtaaa
gaggaacttggaacagaggccttgggatactgcatggacttccaggccgtgccaggctgt
ggaattggctgtaaagtcaccagcgtggaaggcatcctggcccatagtgggcacctgaac
gaacaggccactcacctgaatggggttggcagtgtcccctcagaaatagatgtagctccc
cagaccttctctgtgctgattgggaaccgagaatggatgaggcgcaatggcttagccatt
tccagcgacatcagtgacgctatgacagaccatgagatgaagggccagacagccatcttg
gtggctattgacgggctgctctgtgggatgatcgccatcgcagatgccgtcaagcaggag
gccgccctggccgtgcacacactgaaaagcatgggcgtggacgtggttctgatcacgggc
gacaatcgcaagacagccagagccatcgccacccaggttggaatcaacaaagtctttgca
gaggtgctgccttctcacaaggtggccaaggtccaggagctccagaaagaagggaagaaa
gtcgccatggtgggagatgggattaacgactccccagccttgacccaggctgatataggc
atcgccattgggacaggcacagatgtcgccattgaggcagctgacgttgttcttatcaga
aatgacttgcttgatgtggtcgctggcattcacctctccaagaggactgtctggagaata
cgactcaacctggtgctggcgttgatctacaacctggttgggatacccatcgcagcaggt
gtcttcatgcccttgggcattgtgctgcagccatggatgggctcagcggccatggcagcc
tcctctgtgtctgtggttctttcgtcgctgcagcttaagtgctataagaagcccgacctg
gaaagttacgaggcccaggcccagggccacatgaagcctctgaccgagtcccaggtcagc
gtgcacatcggcatggatgaccggcggtgggacccccccagggccactccctgggaccag
gtcagctacatcagccaggtgtctctgtcctccctgaagtccgacaaactgtcttggcag
agcgccacagctgacgacagtggggacaagtggtctctgctcctgaatgacagagacgag
gagcagtgcatctga

DBGET integrated database retrieval system