KEGG   Miniopterus natalensis: 107533063
Entry
107533063         CDS       T05883                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mna  Miniopterus natalensis
Pathway
mna00220  Arginine biosynthesis
mna00330  Arginine and proline metabolism
mna01100  Metabolic pathways
mna04020  Calcium signaling pathway
mna04066  HIF-1 signaling pathway
mna04146  Peroxisome
mna04371  Apelin signaling pathway
mna04926  Relaxin signaling pathway
mna05010  Alzheimer disease
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05133  Pertussis
mna05140  Leishmaniasis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05146  Amoebiasis
mna05152  Tuberculosis
mna05200  Pathways in cancer
mna05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107533063 (NOS2)
   00330 Arginine and proline metabolism
    107533063 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107533063 (NOS2)
   04066 HIF-1 signaling pathway
    107533063 (NOS2)
   04020 Calcium signaling pathway
    107533063 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107533063 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107533063 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533063 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107533063 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107533063 (NOS2)
   05014 Amyotrophic lateral sclerosis
    107533063 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107533063 (NOS2)
   05152 Tuberculosis
    107533063 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107533063 (NOS2)
   05145 Toxoplasmosis
    107533063 (NOS2)
   05140 Leishmaniasis
    107533063 (NOS2)
   05142 Chagas disease
    107533063 (NOS2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107533063 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 107533063
NCBI-ProteinID: XP_016063124
LinkDB
Position
Unknown
AA seq 1139 aa
MKEPDINNNTDKTMRVPYSAVTQDDPKCHSLGKHRNESPQPFTGTGKKSPESLVKLDAPP
SACPQHVRIKNWGSGMTFQDTLHHKAKGDLACKSKCCLGAIMNSKSLTRGPRDRPTSPDE
LLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIYATKQAWRNAP
RCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNIRSAITVFPQRSDGKHDFR
VWNAQLIRYAGYQMPDGTIRGDPACLEFTQLCIDLGWKPKYGRFDVVPLVLQAGGRDPEL
FEIPPDLVLEVPMEHPKYEWFRELGLKWYTLPAVSNMLLEVGGLEFPGCPFNGWYMGTEI
GVRDFCDAQRYNILEEVGRRMGLETHKLASLWKDQAVIEINVAVLHSFQKQNVTIMDHHS
AAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEMLNYVLSPFYYYQVEAWKT
HVWQDEKRRPQRRVIRFQVLAKAVLFASMLIRKTMASRVRATILFATETGRSETLARDLG
ALFSCAFNPKVLCMDEYRLSSLEEERLLLVVTSTFGNGDSPGNGEKLKKSLFMLKKLTNK
FRYAVFGLGSSMYPQFCAFAHDVDQKLSHLGASQLTPTGEGDELSGQEEAFRSWAVQTFK
AACEAFDVRGKHCIQIPKLYTTSVTWDPRHYRLVQDSQPLDLNKALSSMHAKNVFTMKLK
SRQNLQSPKSSRSTLLVELSSEGSQGLSYLPGEHLGVFPSNQPALVQGILERVVDNPAPH
QPVCLETLSETGSYWVRDKRLPPCSLSQALTYFLDITTPPTQLLLRKLAQLASEEAERQR
LETLCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQLPVLKPRYYSISSSRDCTP
TEIHLTVAVLTYHTRDGQGPLHHGVCSTWLSSLEPQDPVPCFVRSASGFQLPENTSHPCI
LIGPGTGIAPFRSFWQQRLHDAEHKGLQCGHMTLVFGCRRPDEDHLYREEMLEMARRGVL
HAVHTAYSRLPGQPKVYVQDILQQKLATEVLHVLHKEQGHLYVCGDAHMARDVAHTLKQL
VAAKLSLSEEQVEDYFFQLKSQKRYHEDIFSAVFPYKVKRDGAAGQPSDPRAPAAHRRS
NT seq 3420 nt   +upstreamnt  +downstreamnt
atgaaggaaccagacatcaacaacaatacagacaaaaccatgcgggttccctacagtgca
gtgacacaggatgaccccaagtgtcacagccttggcaagcaccggaatgagtccccccag
cccttcacggggacaggaaagaagtctccagaatccctggtcaagctggatgcaccccca
tcagcctgcccacagcatgtgaggatcaaaaactggggcagtggaatgactttccaagac
acacttcaccacaaggccaaaggggacttggcttgcaaatctaagtgttgcttgggagcc
atcatgaactccaaaagtttgaccagaggacccagggacaggcctacctctccagatgag
cttctacctcaagctatcgaatttgtcaaccagtattacagctccttcaaagaggcaaaa
atagaggaacatctggccagggtggaagctgtaacaaaggagatagaaacaacaggaacc
taccagctgacgggagatgagctcatctacgccaccaagcaggcctggcgcaatgccccg
cgctgcatcgggaggatccagtggtccaacctgcaggtctttgatgcccggagctgttcc
actgcccaggaaatgttcgagcacatctgccgacacctgcgatatgccaccaacaatggc
aacatcaggtcggccatcaccgtgttcccccagcggagcgatgggaagcatgacttccga
gtctggaacgcacagctcatccgctacgccggctaccagatgcctgatggcaccatcaga
ggggaccctgcctgcctggagttcacccagctgtgcatcgacctgggctggaaacccaag
tatggccgcttcgacgtggtgcctctggtcctgcaggctggtggccgcgaccctgagctc
tttgaaatcccgcctgaccttgtgctcgaggtgcctatggaacatcccaagtatgagtgg
ttccgggagctggggctgaagtggtacaccctgcctgcagtgtccaacatgctgctcgag
gtgggtggcctcgagttcccagggtgccccttcaacggctggtacatgggcacagagatt
ggggtccgggacttctgtgatgctcagcgctacaacatcctggaggaagtgggcaggagg
atgggcctggaaacgcacaagttggcctcactctggaaggaccaggctgtcattgagatc
aatgtcgctgtgctccacagtttccagaagcaaaatgtgaccatcatggatcaccactca
gctgcggagtccttcatgaagtacatgcagaatgagtaccggtcccgagggggctgccct
gccgactggatctggctggtgcccccgatttctggaagcatcacccccgtgttccaccag
gagatgttgaactatgttctgtcccccttctactactaccaggtggaggcctggaaaacc
cacgtctggcaggacgagaagaggagaccccagagaagagtgattcgattccaagtcttg
gctaaagccgtgctcttcgcctctatgctgatacgcaagaccatggcgtcccgggtcaga
gccaccatcctctttgcgacggagacgggaagatcagaaacgctggcccgggacctcggg
gccctgttcagctgtgccttcaaccccaaggttctctgcatggacgagtacaggctaagc
agcctggaggaggagcggctgctgctggtggtgaccagcacgtttgggaacggagactcc
cccggcaatggagagaaactgaagaaatctctcttcatgctgaaaaagctcaccaacaag
ttcaggtatgccgtgttcggcctcggctccagcatgtaccctcagttctgcgcctttgct
cacgatgtcgaccagaagttgtcccacctgggagcgtctcagctcaccccgacaggggaa
ggagatgagctcagtgggcaggaagaggccttccgcagctgggctgtgcaaaccttcaag
gcagcctgtgaggcattcgatgtccgaggcaaacactgcattcagatccccaagctctac
accaccagtgtgacctgggacccgcgccactacaggctcgtgcaggactctcagcctctg
gacctcaacaaagccctcagcagcatgcacgccaagaacgtgttcaccatgaagctcaaa
tcgcggcagaatctacagagtccgaaatccagccgctccaccctcctggtggagctctcc
agcgagggcagccaaggtctcagctacctgccgggagagcacctgggggttttcccaagc
aaccagccggccctggtgcaaggcattttggagcgagtggtggacaaccccgcaccccac
caacccgtgtgcctggagaccctcagtgagaccggcagctactgggtcagggacaagcgg
ctgcccccctgctcactcagccaggccctcacctacttcctggacatcaccacaccccca
acccagctgctgctccgaaagctggcccagctggcttcagaagaggccgagaggcagagg
ctagagaccctgtgccagccctcagagtacaacaagtggaagttcaccaacagccccaca
ttcctggaggtgctggaggagttcccgtccctgcgggtatctgccagcttcctgctttcc
cagctccctgtcctgaaaccccgatactactccatcagctcctccagggactgcaccccc
acagagatccacctcaccgtggccgtgctcacctaccacacccgagatggccagggcccc
ctgcaccacggtgtctgcagcacatggctcagcagcctggagccccaagacccagtgccc
tgttttgtacgaagtgccagcggcttccagctccccgagaacacctcccacccttgcatc
ctcattgggcctggcactggcatcgctcccttccgcagtttctggcagcagcgtctccat
gatgccgagcacaaagggctccagtgtggccacatgaccctggtgttcgggtgccggcgc
ccagacgaggaccacctctatcgggaggagatgctggagatggcccggagaggggtgctg
cacgcggtgcacacagcctactcgcgcctgcctggccagcccaaggtctacgttcaagac
atccttcagcagaagctggccaccgaggtgctccacgtgctccacaaggagcaaggccac
ctctatgtctgtggggatgcgcacatggcccgggatgtggcccacacactgaagcagctg
gtggctgccaagctgagcctgagtgaggagcaggtcgaggactatttcttccagcttaag
agccagaagcgctaccatgaagatatcttcagtgctgtgtttccctacaaggtgaaaaga
gatggggcagcgggacagcctagcgatccccgagctccagcagcccacaggagaagttaa

DBGET integrated database retrieval system