KEGG   Miniopterus natalensis: 107533084
Entry
107533084         CDS       T05883                                 

Gene name
ARHGEF12
Definition
(RefSeq) rho guanine nucleotide exchange factor 12
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04360  Axon guidance
mna04611  Platelet activation
mna04625  C-type lectin receptor signaling pathway
mna04810  Regulation of actin cytoskeleton
mna05135  Yersinia infection
mna05152  Tuberculosis
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107533084 (ARHGEF12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107533084 (ARHGEF12)
   04625 C-type lectin receptor signaling pathway
    107533084 (ARHGEF12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107533084 (ARHGEF12)
  09158 Development and regeneration
   04360 Axon guidance
    107533084 (ARHGEF12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533084 (ARHGEF12)
   05205 Proteoglycans in cancer
    107533084 (ARHGEF12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107533084 (ARHGEF12)
   05152 Tuberculosis
    107533084 (ARHGEF12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107533084 (ARHGEF12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107533084 (ARHGEF12)
Membrane trafficking [BR:mna04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107533084 (ARHGEF12)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ_6 PH_13 PDZ Ribonuc_2-5A
Other DBs
NCBI-GeneID: 107533084
NCBI-ProteinID: XP_016063141
LinkDB
Position
Unknown
AA seq 1421 aa
MRAGVQTGDRIIKVNGTLVTHSNHVEVVKLIKSGSYVALTVQGRPPGMPQIPLADSEVEP
SATGHLSPITTSPHSPGASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLL
QEDYNRTPAQRLLKEIQEAKKHIPQLQEQLSKATGSAQDGTVIIPSKPGGDTPAVSEVEA
DPGDGLGRVDCSSGDASWPSSDHADNPRSGLKERTYLEENPEKNEVIQDTDTQSLTMSPS
TRVAPHIIGAEDDDFGTEHEQINGQCSCFQSIELLKSRPAHLAVFVHHVVSQFDPATLLC
YLYSDLYKQTNSKETRRVFLEFHQFFLDRSAHLKVPVPDEISVDLEKRRPELIPEDLHRH
YIQTMQERVHPEIQRHLEDFRQKRSMGLTLAESELTKLDVERDKDRVTLEKERACAEQIV
AKIEEVLMTAQAIEEDKSSTMQYVIFMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMK
KDREGEEKGKRRGFSSILGPPRRPSRHDNNAIGRAMELQKQRHPKHLSTPSPVSPEPQDA
AKSRQSGLASEGADAGYLQASPMSSVATVATLSQDGGKENDMGSKQVGEAPASGDSLDGT
PRTSNTVFDFLPPPLDQVQEEEWEVERMTEHGTPKPFRKLDSIAFGESQSEDEQFENDLE
TDPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGIL
SPSEIRKIFSNLEDILQLHIGLNEQMKTVRKRNETSVIDQIGEDLLTWFSGPGEERLKQA
AATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLL
LDNIAKYTEWPTEREKVKKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKFSE
YLNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHS
KVLASTGDSRHTFSPVITLSTVLVRQVATDNKAFFVISMSDNGAQIYELVAQTVSEKTVW
QDLICQMAASVKEQSTRPIPLPQPPPCEGDNDEEPPKLKVEDQGASVTGPQSPGFSEKSE
IDDLFVAERHFAKEQHADGTVKEVGVNYQVTIPDPHLPISEERWALDALRNLGLLKQLLV
QKLCLAEKSTQEDWPQFSRYRMASPGVQADRGTQNCEMIKAYPPGERQMPLRTGTGVIST
CYSPRTSAESCAPRDSVALAFHHSQASGVSVTSPMVVTPEAPPAEPEGGLDESGEHFFDA
REVHSDDYSPGGDGAVQKEEKGVTLHISGNYLILDGYETVQESCTDEEAASSLTLQPTAG
LPSVDPTQQQQQHSPQNAFSDDTTSPLTPEFLALQHWGATGDSCFEMQRPPTCAASQDRV
LEYICKIEADLEHLKKVEESYTILCQRLAGSALTDKHSEKS
NT seq 4266 nt   +upstreamnt  +downstreamnt
atgcgggccggagtacagacaggtgatcgaatcatcaaggtgaatgggactctggtgact
cattcaaatcacgtggaggtggtgaagttaatcaaatctggttcctatgtagccctcact
gttcagggacgcccacctgggatgccccagattccacttgctgattctgaagtagagcca
tcagccaccggacatctgtcgcccatcacgacatcccctcactcaccgggagcatcgggg
aatatggagagaatcaccagtcctgtgctcatgggggaggaaaacaatgtggttcataac
cagaaagtagaaattctgaggaaaatgttacagaaagaacaggaacggctacagttactg
caggaagattacaaccgaacccctgcccaaagattgctaaaagagatccaagaggccaag
aaacacattcctcagctgcaagagcagttatccaaagccacgggctctgctcaggatgga
accgtaattataccctccaagcctggaggtgatactccagcagtcagtgaggtcgaagca
gaccctggggatggactgggccgagttgactgtagcagtggagatgcttcatggcccagt
agtgaccatgcggataatcctaggagtggcctgaaagagaggacttatctcgaggaaaac
ccagagaaaaatgaagtaattcaggacactgacactcagtcacttaccatgagtccctcg
acccgtgtagcacctcatattattggagcagaggatgatgattttggtactgaacatgag
cagatcaatgggcagtgcagctgcttccagagcattgaactgctaaaatctcgccctgct
cacttggctgtttttgtacaccatgtagtgtcacagtttgaccctgcaacattgctctgt
tatctctactcagacctttataaacagaccaattccaaggagactcggcgtgtcttcctc
gagtttcatcagttcttcctggatcgatctgcacacttgaaagttcctgttcctgatgaa
atatcagtagatttagaaaaaagaagacccgagctaattcctgaggatctacatcgccac
tatattcaaactatgcaagaaagagtccacccagaaattcagaggcacttggaagatttt
cggcagaaacggagcatgggcctgaccttggctgaaagcgaactgactaagcttgatgta
gagcgagacaaggaccgggtaactttggagaaggaacgggcatgtgcagaacagattgtt
gccaaaattgaagaagtgttgatgactgctcaggctatagaagaagataagagttcaacc
atgcagtatgttattttcatgtacatgaagcatttgggagtaaaagtgaaagaacctcga
aatttggagcataagcggggtcggattggattccttccaaaaatcaagcaaagtatgaag
aaagatagggaaggcgaagaaaaagggaagcgaagaggattctccagcatcctgggaccc
ccaaggagaccaagccgtcatgacaacaacgcaattggcagagccatggagctacagaag
cagcgccaccctaagcatttatccacaccctcacctgtgagtcctgaaccccaggatgct
gctaagtcacgccagagcgggctggcaagtgaaggagcagacgctgggtacctgcaggcc
agtcccatgtcctcggtggccacagtggccactctttcccaagacggagggaaagagaat
gatatgggatcaaagcaagttggagaagcaccagcatctggagactccttagatggcaca
cctcgtacttccaataccgtctttgattttctgcctcctccattagaccaggtgcaagag
gaggaatgggaagtagaaagaatgactgaacatgggacaccaaagccctttcgaaagtta
gacagcatagcttttggagaaagtcaaagtgaggatgaacagtttgaaaatgacttagag
acagatccacccaactggcaacagctcgttagtcgagaagtgttattgggactaaagcct
tgtgaaatcaaaaggcaggaagtaattaatgaattgttttatactgaaagagctcatgtt
cgaacactaaaggttcttgatcaagtgttctatcagcgagtgtccagagaaggaattctg
tcaccttcagaaatacggaaaattttttcaaacttggaagatattcttcaacttcacatt
gggttgaatgagcaaatgaagactgttcgaaagagaaatgagacttctgttattgatcaa
attggggaagatttgctgacctggttcagtgggccgggggaggagaggctgaagcaggca
gcagcgaccttctgcagtaaccagccttttgccctggaaatgatcaaatctcgtcagaaa
aaggattctcgattccagacttttgtgcaagatgctgagagtaatccattgtgccggcgt
ctgcagctgaaggatatcattcccacccaaatgcagaggctcaccaagtaccctcttctg
ttggacaacattgctaaatacacagagtggccgacagaaagagagaaggtcaagaaagct
gcagatcactgtcgtcagatcttaaattatgtaaatcaggctgtcaaagaggcagaaaac
aagcagcgtttagaagattaccagcgtcgccttgatacctccaatctgaagttctcagag
tacctaaatgttgaagagctcaggaatttggatctaacaaaaaggaagatgattcatgaa
gggccattggtttggaaggtgaacagagataaaaccatcgatctgtatacactgctgctg
gaggacatcctcgtgttgctacagaagcaggatgacaggctggtgttgaggtgccacagc
aaggtcctggcatccacgggtgacagcaggcacaccttcagccctgtcattaccttgagc
acagtgctggttcgacaggtggccacagataacaaagctttcttcgtcatctccatgtca
gacaatggagcccaaatttatgaactggtggcacagacagtttctgaaaaaactgtctgg
caggacctaatctgccagatggctgcatcagtgaaggagcaatccacgaggcccatccca
ctgccacagccgccaccttgcgaaggagacaatgatgaagagcctccaaagttaaaagtg
gaggatcagggcgcgtcggtcactggcccgcagagcccaggcttctctgagaagtcagag
atagacgatctctttgtggctgagagacatttcgcaaaggagcagcatgcagatggaact
gtaaaggaagttggagtaaattatcaagtcacaatcccagatccacacttacccatctca
gaagagcggtgggcattggatgcactacggaatttgggtttgttgaagcagctgctggta
cagaagctgtgtctcgctgagaagagcactcaagaagactggccacagttctcaagatac
agaatggcctctccaggggtgcaggcagacaggggaacccagaactgtgaaatgattaag
gcctatcctcctggtgaaagacagatgccccttagaactggaactggtgtcatttcaact
tgctacagtccacggacttcagctgagtcttgtgctccacgggattctgtggcactggca
ttccaccatagccaggcaagcggcgtttcagtaacgagccccatggtggtgaccccagag
gctcctcctgcagagccagaaggaggtctggatgagagtggagagcacttttttgatgcc
cgtgaagtgcatagtgatgattattcaccaggaggcgatggagcagttcaaaaggaagag
aagggtgttaccctacacatctcaggaaactacttgatcctcgatggctatgaaacagtg
caggagagctgcaccgacgaggaggctgcttcctcactcaccctgcagcccaccgcaggc
ctcccctctgtggaccccactcagcagcagcagcagcattctccccagaatgctttttct
gatgacacaacttcaccactcaccccagaattcctggctctgcagcactggggagcaaca
ggggactcctgctttgagatgcagaggccccccacttgtgcagcttcacaagaccgggtc
ctggagtacatttgtaagatagaagctgacctcgaacacctaaagaaggtggaggaaagt
tataccattctttgccaaaggctcgcaggatcagccctcacagacaaacactcagaaaaa
agctag

KEGG   Miniopterus natalensis: 107534237
Entry
107534237         CDS       T05883                                 

Gene name
ARHGEF1
Definition
(RefSeq) rho guanine nucleotide exchange factor 1
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04611  Platelet activation
mna04810  Regulation of actin cytoskeleton
mna04928  Parathyroid hormone synthesis, secretion and action
mna05135  Yersinia infection
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107534237 (ARHGEF1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107534237 (ARHGEF1)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107534237 (ARHGEF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107534237 (ARHGEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534237 (ARHGEF1)
   05205 Proteoglycans in cancer
    107534237 (ARHGEF1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107534237 (ARHGEF1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107534237 (ARHGEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107534237 (ARHGEF1)
Membrane trafficking [BR:mna04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107534237 (ARHGEF1)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PH_13 AbiJ_NTD3
Other DBs
NCBI-GeneID: 107534237
NCBI-ProteinID: XP_016064752
LinkDB
Position
Unknown
AA seq 913 aa
MEADSVVGRGAAPGPPRPGLVPVSIIGAEDEDFENELETNTEEQNSQFQSLEQVKRRPAH
LMALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVSVPSTV
AFELDRTRPDLISEDVQRQFVQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQELAQLEAW
VGRDRASFEARERHVAERLLAHLEEMQHTISTDEEKSAAVVSAISLYMRHLGVRTKSGDK
KSGRNFFRKKVMGNRRSDEPTKTKKGLSSFLDAARWNRGEPQAPDFRHLKAEADVEKPGL
IERKGGLGVPSRNVGTPGQDSPGVSLQPLSGDSPDREPGVDASPELGDLPLQGPASLEPP
APLESTEEGPETESPEPGDEGEPGRSGLELEPEEPPGWRELIPPDTLHSLPKSQVKRQEV
ISELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLEELQNIFPSLDELIEVHSLFLDRLMK
RRQESGYLIEEIGDVLLARFDDAEGAWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFV
QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAEREKVELAAECCREILH
HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTK
DKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVAT
DHKAFYVIFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSST
REPLLSSSENGNGGNREMPLADGRIERTLSTLLPFCRPGPEGQLAAKALQKVLSLKQLLL
PSEEDSGAGPPPEGDGVPGGSPLSPTQTQEIREELLGLEDTIKQLEEVEEEFCRLRLILS
QLRENTVPQSGCT
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggaggcagacagcgtcgtgggccgaggggcggccccagggcccccccggcctggcctg
gtgcccgtcagcatcattggggctgaagacgaggatttcgagaacgaactggagacgaac
acagaggagcaaaacagccagttccagagcctggagcaggtgaagcggcgcccagcccac
ctgatggccctcctgcagcacgtggccttgcagttcgagccaggacccctgctctgctgc
ctacatgcggacatgctgggctctctgggccccaaggaggccaagaaggccttcctcgac
ttctaccacagcttcctggagaaaaccgcggttctgcgagtctctgtcccttccacagtc
gcctttgaacttgaccgcacgaggcctgacctcatctccgaggatgtccagcggcagttc
gtgcaggaggtggtgcagagccagcaggcagctgtcagccggcagttggaggacttccgc
tccaagcggctcatgggcatgacaccctgggagcaggagctggcccagctggaggcctgg
gtggggcgggaccgcgccagcttcgaggcccgggagcggcacgtggcagagcggctgctg
gcccacttggaggagatgcaacataccatctctactgatgaagaaaagagtgccgctgtg
gtcagtgccatcagcctgtacatgcgccacctcggggtgcggaccaagagtggggacaag
aagtcggggaggaatttcttccgaaaaaaggtaatggggaaccggcgatcagatgagcca
accaagaccaagaaaggactgagcagcttcctggatgccgcccgatggaaccggggagag
ccccaggccccagattttcgacatctcaaagcagaggctgatgtggagaagccaggcctc
atagaacggaagggaggcctgggggtgccctcccggaatgttgggacccctgggcaggac
tcccctggagtttcactgcagcctctgtccggagacagccctgaccgggaaccaggtgtt
gatgcctcaccggagctgggggacctgcccctgcagggcccggccagcctggagccccca
gcgcccctggagagcactgaggagggtcctgagacagagagccccgagcctggagatgag
ggggagccgggacggtcgggactagagctggaaccagaagagccccccggctggcgggag
ctcatccccccagacaccctgcacagcctgcccaagagccaggtgaagcggcaggaggtc
attagcgagctgctggtgacggaggcggcccatgtgcgtatgctgcgggtgctgcacgac
ctcttctaccagcccatggctgacgggggcttcttccccctggaggagctacagaacatc
ttccccagcctggacgagctcatcgaggtgcattccctgttccttgatcgtctgatgaag
cggaggcaggagagcggctacctcattgaggagatcggagatgtgctgctggcccggttt
gatgatgccgagggcgcctggttccagaaaatctcctcccgcttctgcagccgccagtcc
tttgccttagagcagcttaaagccaaacagcgcaaggagcctcgtttctgcgccttcgtg
caggaggctgagagccgcccacggtgccgccgcctgcagctgaaggacatgatcccgacg
gagatgcagaggctgaccaagtaccctctgctcctgcagagcatcgggcagaacacagaa
gagccagcagaacgggagaaagtggagctggcagctgagtgctgccgggagattctgcac
cacgtcaaccaggctgtgagggacatggaggacctgctgcggctcaaggattatcagagg
cgcctggacttgtcccacctgaggcagagcagtgaccccatgctgagcgagttcaagaac
ctagacatcacaaagaagaagctggtccacgagggcccactgacgtggagggtgacaaag
gacaaggctgttgaggtccatgtgctgctgctggacgacctgctgctgctgctccagcgc
caggatgagcggctgctgctcaaatcacacagccggacgctcacgcccacgcccgacggc
aagaccatgctgcggccggtgctgcggctcacgtccgccatgacccgtgaggtggccacc
gatcacaaagctttctatgtcatttttacctgggaccaggaggcccagatatacgagctg
gtggcgcagaccgtgtcagagcggaagaactggtgtgcccttatcactgagaccgcagga
tccctgaaggtccccgctcctgcctcccgccccaaaccccggcctagccccagcagcacc
cgtgaacccctgctcagcagctctgaaaatggcaacggtggcaaccgagagatgcccctg
gctgatggccggatcgagagaaccctcagcaccctcctgcccttctgcaggccaggccct
gagggccagctcgctgccaaagcccttcagaaagtgttgtccctgaagcagctcctgctc
ccctcagaggaagacagcggggcagggcctccccctgaaggggatggagttccagggggc
agccccctgagccccacacagacccaggaaatccgagaggagctacttggcctggaggac
accattaaacagctggaggaggtggaggaggagttctgtcgcctgcgactcatcttgtct
cagctcagagagaacactgtcccccagtctggctgtacctga

KEGG   Miniopterus natalensis: 107543803
Entry
107543803         CDS       T05883                                 

Gene name
ARHGEF11
Definition
(RefSeq) rho guanine nucleotide exchange factor 11 isoform X1
  KO
K12331  Rho guanine nucleotide exchange factor 11
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
mna04928  Parathyroid hormone synthesis, secretion and action
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107543803 (ARHGEF11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107543803 (ARHGEF11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543803 (ARHGEF11)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107543803 (ARHGEF11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107543803 (ARHGEF11)
Membrane trafficking [BR:mna04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107543803 (ARHGEF11)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 RGS PH_13 PH
Other DBs
NCBI-GeneID: 107543803
NCBI-ProteinID: XP_016076902
LinkDB
Position
Unknown
AA seq 1564 aa
MSVRLPQSIDRLSSLSLGDSAPERKSPSHHGQPSDTSETTGLVQRCVIIQRDQHGFGFTV
SGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLG
SSPSVGVSGLQQDPDPAGAPQVTPVIPPPPPPPPLPPPQRITGPKPLQDPEFQKHATQIL
RNMLRQEERDLQHICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDVLPLYGN
ISQRSSEGRLSLDSQDGDSGLDSGTERFPSLSEPLINRNSVLSDPGLDSPRTSPVIMARV
AQHQRWQGSDAPGPPTSDQGVDQNPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSRPA
HLGVFLRYIFSQADPSPLLFYLCAEVYQQTNSKDSRSLGKDIWNIFLEKNAPLRVKVPET
VQAEIDSRLRSGEDLRGVLSEAQEATMPEIQEQIQDYRTKRTLGLGSLYGENDLLDLDGD
PLRERQVAEKQLAALGDILFKYEEDRSAPMDFALNTYMSHAGIRLREARSSSAAEKAPSS
APDKDKWLPFFPKTKKQSSNAKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEV
KPGNVRNIILHFENSQQYDAPEPGTQRLSTGSFPEDLLENDSSRSEIRLGRSESLKGREE
LKRSRKTENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRRSI
ESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDTQNWQHTVGKDVVAGLSQREIDRQEVIN
ELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLR
EEGPIIREISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEA
ESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYV
NEAVKQTENQHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDK
RAFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVQNATRHPGAAPTPVHPPPPGPR
ESTHRSPRSSRVGLDDSEVFQSEPEPEELPGGTEPQQRVTGKHSVLLEGPKREGSIEEKE
LSALPHPSTSLNGENRGGRTRDPIVLPLPDPLFMEGLADAALEDVENLRHLILCGRLPGH
PREPQAAGEPEDDLTPTPSVVSITSHPWDPGSPGRAPTGGEGESTQLPGPEGGQPEQEDM
ALCSLDHLPPRTRNSGIWEPPELDRNPEEEAPSTEAAGSYKVVRKAEVAGSKAVPALPES
GQSEPEPPEVEGGAKATGNCFYVSMPAGPLDSSTDSSGVPTDLSQPDSLPAWQTEPQPQL
QGGSGDQRRPSCSPPSLAFRDMGIIFRTIEQLTLKLNRLKDMELAYRELLRSLGGESSGG
TTPVGSFHTEAARWIDSSLSPPVKEPSSSDSRDSHELEPCPEDRASNPLEDRAADAATSP
FPGL
NT seq 4695 nt   +upstreamnt  +downstreamnt
atgagtgtaaggttaccccagagtatagacaggttaagtagcctgtctttgggagattca
gcacctgagcgcaagtccccttcccaccacggccaaccctctgacacctctgagacaaca
ggtcttgttcaacgctgtgtcatcatccagagggaccagcatggcttcggcttcacagtc
agtggggatcgcattgttctggtacagtctgtgcggcctggaggtgcagccatgaaagcc
ggtgtgaaagagggcgaccggatcatcaaggtgaacggcaccatggtgaccaatagctca
cacctggaggtggtgaagcttatcaaatctggtgcctatgttgcactgaccctcctgggc
tcttcaccctccgttggtgtctctgggctccagcaagacccagacccagcaggagctccc
caggtcacccctgtgatcccaccaccaccacctcctccacccctgccaccaccacagcgc
atcacaggacccaaacctctgcaggatcccgaatttcaaaaacatgccacccagatcctt
aggaacatgctgaggcaggaggaaagagacttacagcatatctgtgaggtgtatagccgg
aaccccgccagcctgctagaagagcagatcgaaggtgcccggcggcgagtcactcagtta
cagctgaagatccagcaggagactggtggcttagtggatgtacttccactatatggtaac
atcagccagagatcatcagaaggccgactttctctggattcacaggacggggacagtggc
ttggactctgggacagaacgcttcccttccctcagtgagccactgataaatcggaactca
gttctgtcagaccctggattagacagtcctcgaacctcccctgtgatcatggccagggtg
gcccagcaccagaggtggcagggttcggatgccccaggcccccccaccagcgaccagggt
gtagatcaaaacccaaagcctttaattattggcccagaggaagattatgacccgggttat
ttcaacaacgagagtgacatcatattccaggatcttgagaaacttaagtcacggccagct
cacctgggggtttttctacgttacatcttctctcaggcggaccccagcccactgcttttc
tacttgtgtgcagaagtttatcagcagacaaactccaaggattcccgaagtttaggaaaa
gacatctggaatattttcctagagaaaaatgcgccactgagagtgaaggtcccagagacg
gtacaggctgaaatcgattcgcgcttgcggagcggtgaggacttacgcggcgttctctct
gaggcgcaggaggcaaccatgcccgagatccaggagcagatccaggactacagaacgaag
cgcaccttgggactgggcagcctgtatggtgaaaacgacttgctggacctggatggggac
cctctccgagagcgccaagtggctgagaagcagctggcagccctgggagatattctgttc
aaatatgaggaagacaggagcgcccccatggactttgccctcaacacctacatgagccat
gctgggatccggcttcgagaggcacggtcttcaagcgcggctgaaaaggccccgtcgtct
gctcctgacaaagacaagtggcttcccttcttcccaaagaccaagaagcagagcagcaat
gccaagaaggaaaaggatgccttggaggacaagaagcgaaaccccattctcaaatacatc
gggaagcccaaaagctcatcccagagtacatttcatatccccttgtcccctgtggaagtt
aaaccaggcaatgtgaggaacatcattctgcactttgagaacagccagcagtatgatgcc
ccagaacctgggacacagcgactctcgacaggaagctttcccgaggacctcctggagaac
gacagctcacgctcagagattcgtttgggccgctctgagagcctgaagggtcgggaggag
ctgaagcgctctcggaagacagagaatgtgccccgctctcgcagtgatgttgacatggat
gctgctgcggaggctgctcgcctccaccagtcagcctcatcatctgcctccagcctctcc
accaggtctcttgagaacccaacccctcccttcacccccaaaatgggccgcaggagcatt
gagtcccccagcttggggttctgcacagatgccctcctccctcacctcctagaggatgat
ctgggccagctgtctgacctggagccagagccagacacccaaaactggcagcacaccgtg
ggcaaggacgtggtggctgggctaagccagagagagattgatcggcaggaggtcatcaat
gagctgtttgtgacagaggcttctcatctacgcacactccgggtcctggacctgatcttc
tatcagcgaatgaagaaggagaacctgatgccccgggaggagctagcccgtctcttcccc
aacctgcccgaacttatagagatccacaattcctggtgtgaagccatgaagaagctccgg
gaggagggtcccatcatcagagaaatcagtgacctcatgctggctcggtttgatggcccc
gcccgagaggaactccagcaagtggccgcccagttctgctcataccaatccatagccctg
gagctgatcaagactaagcagcggaaggagagccgattccagctcttcatgcaggaggcc
gagagccaccctcagtgccgacggctgcagctgcgggacctcatcatctctgaaatgcag
cggctgaccaagtacccactgctgctggagagcatcatcaagcacacggagggtggcact
tctgagcacgagaagctctgccgggcccgggatcagtgccgggaaattctcaagtatgtg
aatgaagcagtaaagcagacagagaaccagcaccgtttagagggctaccagaagcgcctg
gacaccacctccctggagagggccagcaatcccttggcagcagaattcaagagcctggat
cttacaaccagaaagatgatccatgaggggcctttgacctggaggatcagcaaggataag
accctggacctccatgtgctgctgctggaggacctccttgtgctgctgcagaaacaggac
gagaagctgctgctcaagtgccacagcaagacagctgtgggctcctcagacagcaagcag
accttcagccccgtgctcaagctcaatgccgttctcatccgctccgtggccacagataaa
cgggccttcttcatcatctgcacctccgagttgggcccaccccagatctatgagctggtg
gcattgacatcatcagacaagaacacgtggatggaactcttagaagaagctgtgcagaac
gccaccaggcacccaggagctgccccgacgcctgtccatcccccacccccaggtccccgg
gagtcaacccaccggagccccaggtccagcagggtaggactggatgactcagaagtattt
caaagtgaaccagaaccagaggagctccctggaggtactgagccccagcagagagtcaca
gggaagcactcggtcctgctcgagggccccaagcgtgagggcagcatagaagaaaaggaa
ctgagtgccctgcctcacccttccacatcccttaatggagagaacaggggtggcaggaca
agggaccccatcgtcctgcccctcccagaccctctcttcatggaaggacttgccgatgca
gccctagaagatgtggagaacctgcggcacctgatcctctgtggccggctgccaggtcac
cccagggaaccacaggctgctggggagcctgaagacgacctgacacctacaccttctgtc
gtcagcatcacctctcacccctgggacccaggctcccctggacgagctcccactgggggt
gaaggggagagcacccagctcccagggccagaggggggccagccagagcaggaggacatg
gctctctgctctctggaccacctacccccaaggaccagaaattctgggatctgggaacct
cctgagctggataggaatccagaggaagaagctccaagcacagaggcagcaggaagttac
aaagttgtgagaaaagctgaggtggcaggcagtaaggctgtccctgcactaccagagagt
ggccagtcagagcctgagccacctgaagtggaaggcggagcaaaggctacggggaactgt
ttttatgtgagcatgccagcaggacccctggactcaagcaccgactcctcaggggtaccc
acagacctctcgcagcctgacagcctccctgcctggcagacagagcctcagcctcagctg
cagggaggcagtggagaccaaaggcgccccagctgctctccccccagcctggctttcagg
gacatgggcataatcttccgaaccattgagcaactcaccctcaagctcaacagactcaag
gacatggagctggcctacagagagctgctcaggtccctcgggggagagtcctctggtggc
accacgcctgtgggcagtttccacacagaagcggctagatggatagacagctccctgtca
cctccagtgaaggagccctcatcctctgactccagggacagccacgaactggagccctgc
cctgaggacagagccagcaaccccctggaagacagggcagcagacgcagccacatcccca
ttcccaggactgtaa

DBGET integrated database retrieval system