KEGG   Miniopterus natalensis: 107533158
Entry
107533158         CDS       T05883                                 

Gene name
MOS
Definition
(RefSeq) proto-oncogene serine/threonine-protein kinase mos
  KO
K04367  proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna04114  Oocyte meiosis
mna04810  Regulation of actin cytoskeleton
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107533158 (MOS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107533158 (MOS)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107533158 (MOS)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107533158 (MOS)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  MOS family
   107533158 (MOS)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 107533158
NCBI-ProteinID: XP_016063221
LinkDB
Position
Unknown
AA seq 355 aa
MPSPLPRRGRLQSEGSPSLDSRPCSSPSELPGRAGKLFPGATPPRTPRLPRRLAWCSIDW
EQVCFLQRLGAGGFGLVHKATYRGALVAIKQVHRRTRHPRAARRSFWAELNVARLRHENI
VGVVAASTRTPAGLQSSGAIIMEFGGDVTLHQVIYGATSGPEAQDAEPHCRAGEQFTLSR
CLKYAVDIASGLLFLHSRGVVHLDLKPANILISERDVCKIGDFGCSEKLEDLPSFRTPSH
AGGTYTHRAPELLKGEAVTPKADIYSFAITLWQMTAREAPYSGERQYVLYAVVARDLRPS
LSAAVFRGSSPGRRLGGVIQDCWRASAPRRPSAHLLLAHLGSLKAEFADPKPVSR
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgccctcgcctctcccgcggcgcggtcgcctgcagagcgagggctcgccctctctggac
tccaggccctgcagtagcccctcggagctcccaggtcgcgcagggaagctcttcccgggg
gccacccctcccaggaccccaaggctgccacgccggctggcctggtgctccatcgactgg
gagcaggtgtgcttcctgcagaggctgggagctggcggcttcggcttggtgcacaaggcg
acctaccgcggcgcgctcgtggccatcaagcaggtgcaccggcgcacgcggcacccgcgg
gcggcccggcgcagcttctgggcggagctcaacgtggcgaggcttcgccacgagaacatc
gtgggggtggtggccgccagcacgcgcacgcccgccggcttgcagagctcgggcgccatc
atcatggagtttggtggcgacgtgactttgcaccaggtcatatacggagccacgagcggc
ccggaggcgcaggacgcggagcctcactgccgtgcgggggagcagttcaccttgtccagg
tgtctcaagtacgccgtggatatcgcgagcggactgcttttcctgcactcgcgaggcgtt
gtgcacttggacctgaagccggccaacattctgatcagtgagcgggacgtctgcaaaatc
ggcgacttcggttgttcggagaagctagaggatctcccgagcttccggacgccttcccac
gctggcggcacgtacacccaccgggcccccgagctcctgaagggcgaggccgtgacgccc
aaggccgacatctattccttcgccatcacgctctggcagatgactgcccgggaggcgccc
tactccggggagcgccagtacgtgctgtacgcggtcgtggcgcgcgacctgcggccctcg
ctctcggcggcggtcttcaggggctccagccccgggaggaggctcgggggcgtcatccag
gactgctggagggccagtgccccgcggcggccgagtgcacacctcctcctggcccacctt
ggctcgctgaaggccgaattcgctgacccgaaacctgtatcaagataa

DBGET integrated database retrieval system