KEGG   Miniopterus natalensis: 107533206
Entry
107533206         CDS       T05883                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04670  Leukocyte transendothelial migration
mna04810  Regulation of actin cytoskeleton
mna04935  Growth hormone synthesis, secretion and action
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05205  Proteoglycans in cancer
mna05222  Small cell lung cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107533206 (PTK2)
   04370 VEGF signaling pathway
    107533206 (PTK2)
   04151 PI3K-Akt signaling pathway
    107533206 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107533206 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107533206 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107533206 (PTK2)
   04062 Chemokine signaling pathway
    107533206 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107533206 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    107533206 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533206 (PTK2)
   05202 Transcriptional misregulation in cancer
    107533206 (PTK2)
   05205 Proteoglycans in cancer
    107533206 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107533206 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107533206 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107533206 (PTK2)
   05100 Bacterial invasion of epithelial cells
    107533206 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107533206 (PTK2)
   05163 Human cytomegalovirus infection
    107533206 (PTK2)
   05165 Human papillomavirus infection
    107533206 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107533206 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107533206 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107533206 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107533206 (PTK2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107533206 (PTK2)
Protein kinases [BR:mna01001]
 Non-receptor tyrosine kinases
  FAK family
   107533206 (PTK2)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107533206 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 107533206
NCBI-ProteinID: XP_016063286
LinkDB
Position
Unknown
AA seq 1086 aa
MAAAYLDPNLNHTPNSSTKTHLGTSVERSTGTMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHLDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYNLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLRTTSMPVVQSCYLQEVGHIGSVRTWRKYKEATILNTILEEEKAQ
HEERLRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSG
YPGSHGITAMAGSMYLGQASLLDQTDSWNHRPQEISMWQPNMEDSAALDLRGIGQVLPTH
LMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSVDREDGSLQGPTGNQHIYQPVGK
PDPAGPPKKPPRPGAPGHLGSLASLSSPGDSYNEGVKLQPQEISPPPTANLDRSNDRVYE
NVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPSLPASTHREIEMA
QKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKML
GQTRPH
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggcagctgcttacctggacccaaacttgaatcacacaccaaattcgagtaccaagacg
cacctgggtaccagtgtggaacgttccacgggaaccatggagcgcgtgctaaaagtcttt
cattattttgaaagcaacagcgagccgaccacttgggccagtattatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcacgtg
gcctgctatggatttcggctcagtcacctgcggtcagaggaggttcactggctccacttg
gacatgggcgtctccagcgtgagggagaagtatgagctcgcacacccgccggaggagtgg
aaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagac
aagccaactttgaatttcttctatcaacaggtgaagagcgattatatgttagagatagct
gaccaagtagaccaggatattgctttgaagttgggttgtctagaaatacggcgatcgtac
tgggagatgcggggcaatgcgctagagaagaagtctaactatgaagtattagaaaaagat
gttggtttgaagcggtttttccctaggagtttactggattctgtcaaggccaaaacacta
agaaaactgatccaacagacatttagacagtttgccaacctcaacagagaagagagtatc
ctgaaattctttgagatcctctccccagtgtacagatttgataaggagtgcttcaagtgt
gctcttggttcaagctggattatttccgtggagctggcaatcggccccgaggaaggcatc
agctacctcacagacaagggctgcaatcccacacatctggctgacttcaatcaagtacag
accattcagtattcaaacagtgaagacaaggacagaaaaggaatgctacagctaaaaata
gcaggcgcgccggagcctctgacagtgacagcaccgtccctgactattgccgagaacatg
gctgacttgatcgatgggtactgccggctggtgaatggggcctcgcagtctttcatcatc
agaccccagaaagaaggtgaacgggctttgccatcaataccaaagctggccaacagtgaa
aagcagggcatgcggacacacgcagtctctgtgtcagaaacagacgactatgctgagatc
atagatgaagaagatacctacaccatgccctcaaccagggattatgagattcaaagagaa
agaatagagcttggacggtgtattggagaaggccagtttggagacgtccatcaaggcatt
tacttgagcccagagaatccagctttggcggttgcaattaaaacatgtaaaaactgtact
tccgacagcgtgagagagaaattccttcaggaagccttgaccatgcgccagtttgaccac
cctcacatcgtgaagctgataggtgtcatcacagaaaaccctgtctggatcatcatggag
ctgtgcacacttggagagctgaggtcatttctgcaagtccggaagtacaacttggacctg
gcgtctttgatcctgtatgcctaccagcttagcacagctctcgcatacctggagagcaag
agatttgtgcatagggacattgctgctcggaatgtcctggtgtcttcaaatgattgtgtg
aaattaggagactttggattatcccgatatatggaagacagtacttactacaaagcttcc
aaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgatgtgtggatgtttggtgtatgtatgtgggagatactgatgcatggtgtg
aagccttttcaaggagtgaagaacaatgatgtgatcgggcgaattgagaatggggagaga
ttgccaatgcctccaaattgccctcccaccctctacagccttatgacgaaatgctgggcc
tatgaccccagcaggcggccccggttcactgagctcaaggctcagctcagaaccacgtct
atgcccgtagtccaaagctgctacctgcaagaggttggtcacataggatctgtgcgaact
tggcggaaatacaaagaggccaccatcttaaacacaatcctggaggaggagaaggctcag
cacgaagaacgcttgaggatggagtccagaagacaggtcaccgtgtcttgggactctgga
gggtccgacgaagctccacccaagcccagcagacctggttatcctagtccaaggtccagt
gaaggattttatcccagcccacagcacatggtgcagaccaatcattaccaggtctctggc
taccctggctcacacggaatcacagccatggcgggcagcatgtacctggggcaggcatcc
cttttggaccaaacagattcttggaatcacagaccacaggagatatcaatgtggcagccc
aacatggaggactctgcggcgctggacctacgtgggatcgggcaggtgttgccaacacac
ctgatggaggagcggctgattcggcagcagcaggagatggaggaagaccagcgctggcta
gagaaagaggagaggtttctgaaacctgatgtgcggctctctcgaggcagtgtggacagg
gaggatgggagtctccagggcccgactggaaaccaacacatttatcagcctgtggggaaa
ccagatcctgcaggtccgccaaagaagccaccacgccccggagcccccgggcacctgggc
agccttgccagccttagcagccctggggacagttacaatgagggcgtcaagcttcagccc
caggaaatcagccccccacccactgccaacctggaccgctccaatgacagggtgtatgag
aacgtgacgggcctggtgaaggctgtcattgaaatgtccagcaagatccagccagcccca
cctgaggagtatgtccccatggtgaaggaagtcggcctggccctgcggacattgttggcc
actgtggatgagaccatccccagcctgccagccagcactcaccgtgagatcgagatggcc
cagaagctgctgaactcagacctaggcgagctcatcaacaagatgaagctggcccagcag
tacgtcatgaccagcctgcagcaggagtacaagaagcagatgctgactgctgctcatgcc
ctggccgtagatgccaagaacttgctggacgtcattgaccaggccagactgaagatgctg
gggcagacgagaccacactga

DBGET integrated database retrieval system