KEGG   Miniopterus natalensis: 107533212
Entry
107533212         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome c-like
  KO
K08738  cytochrome c
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04115  p53 signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05222  Small cell lung cancer
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107533212
   04215 Apoptosis - multiple species
    107533212
   04115 p53 signaling pathway
    107533212
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533212
  09162 Cancer: specific types
   05210 Colorectal cancer
    107533212
   05222 Small cell lung cancer
    107533212
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107533212
   05012 Parkinson disease
    107533212
   05014 Amyotrophic lateral sclerosis
    107533212
   05016 Huntington disease
    107533212
   05017 Spinocerebellar ataxia
    107533212
   05020 Prion disease
    107533212
   05022 Pathways of neurodegeneration - multiple diseases
    107533212
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107533212
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107533212
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107533212
   05134 Legionellosis
    107533212
   05152 Tuberculosis
    107533212
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107533212
   05161 Hepatitis B
    107533212
   05160 Hepatitis C
    107533212
   05164 Influenza A
    107533212
   05162 Measles
    107533212
   05168 Herpes simplex virus 1 infection
    107533212
   05163 Human cytomegalovirus infection
    107533212
   05167 Kaposi sarcoma-associated herpesvirus infection
    107533212
   05169 Epstein-Barr virus infection
    107533212
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107533212
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107533212
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 107533212
NCBI-ProteinID: XP_016063293
LinkDB
Position
Unknown
AA seq 136 aa
MLEQLHFTDKKTESQFREQDAGLVSRSLHVACNVEKGKEIFVQKCAQCHTLGKGGKHKTG
PNSLFFFFGXKKGQAPGFSYTDANENKGITWGEATLMEYLGNPKKSIPGAKIIFAGIKKS
AERAGLMAYLKTATNE
NT seq 411 nt   +upstreamnt  +downstreamnt
atgctggaacagctccattttactgataagaaaactgagagtcagtttagagagcaggat
gctgggcttgtaagtaggagcctccatgttgcgtgcaatgttgagaaaggcaaggagatt
tttgttcagaagtgtgcccagtgccatactctagggaagggaggcaagcataagactggg
ccaaattccctgttttttttttttgggtgaaagaaaggtcaggcccctggattttcttac
acagatgccaacgagaacaaaggcataacctggggagaagccacactgatggagtatttg
gggaatcccaagaagtccattcctggagcaaaaattatctttgctggtattaagaagagt
gcagaaagggcaggcttgatggcttatctcaaaacagcaactaatgagtaa

KEGG   Miniopterus natalensis: 107536673
Entry
107536673         CDS       T05883                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04115  p53 signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05222  Small cell lung cancer
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107536673
   04215 Apoptosis - multiple species
    107536673
   04115 p53 signaling pathway
    107536673
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107536673
  09162 Cancer: specific types
   05210 Colorectal cancer
    107536673
   05222 Small cell lung cancer
    107536673
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107536673
   05012 Parkinson disease
    107536673
   05014 Amyotrophic lateral sclerosis
    107536673
   05016 Huntington disease
    107536673
   05017 Spinocerebellar ataxia
    107536673
   05020 Prion disease
    107536673
   05022 Pathways of neurodegeneration - multiple diseases
    107536673
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107536673
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107536673
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107536673
   05134 Legionellosis
    107536673
   05152 Tuberculosis
    107536673
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107536673
   05161 Hepatitis B
    107536673
   05160 Hepatitis C
    107536673
   05164 Influenza A
    107536673
   05162 Measles
    107536673
   05168 Herpes simplex virus 1 infection
    107536673
   05163 Human cytomegalovirus infection
    107536673
   05167 Kaposi sarcoma-associated herpesvirus infection
    107536673
   05169 Epstein-Barr virus infection
    107536673
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107536673
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107536673
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind
Other DBs
NCBI-GeneID: 107536673
NCBI-ProteinID: XP_016067980
LinkDB
Position
Unknown
AA seq 102 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNFHGLFGQKTGQGPGFSYTDANKNKDITW
GEATLMEYLENPKYIPGTKMIFVGIKKSAERAELIAYLKKSH
NT seq 309 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgcgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatttccatggtctgtttgggcaaaag
acaggtcagggccctggattttcttacaccgatgccaacaagaacaaagacatcacctgg
ggagaggctacactgatggagtatctggagaatcccaagtacatccctggaacaaaaatg
atcttcgttggcattaagaagagtgcagaaagggcagaattaatagcttatctcaaaaaa
agccactaa

KEGG   Miniopterus natalensis: 107540285
Entry
107540285         CDS       T05883                                 

Definition
(RefSeq) cytochrome c isoform X1
  KO
K08738  cytochrome c
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04115  p53 signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04932  Non-alcoholic fatty liver disease
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05222  Small cell lung cancer
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107540285
   04215 Apoptosis - multiple species
    107540285
   04115 p53 signaling pathway
    107540285
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540285
  09162 Cancer: specific types
   05210 Colorectal cancer
    107540285
   05222 Small cell lung cancer
    107540285
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107540285
   05012 Parkinson disease
    107540285
   05014 Amyotrophic lateral sclerosis
    107540285
   05016 Huntington disease
    107540285
   05017 Spinocerebellar ataxia
    107540285
   05020 Prion disease
    107540285
   05022 Pathways of neurodegeneration - multiple diseases
    107540285
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107540285
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107540285
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107540285
   05134 Legionellosis
    107540285
   05152 Tuberculosis
    107540285
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107540285
   05161 Hepatitis B
    107540285
   05160 Hepatitis C
    107540285
   05164 Influenza A
    107540285
   05162 Measles
    107540285
   05168 Herpes simplex virus 1 infection
    107540285
   05163 Human cytomegalovirus infection
    107540285
   05167 Kaposi sarcoma-associated herpesvirus infection
    107540285
   05169 Epstein-Barr virus infection
    107540285
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107540285
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107540285
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 107540285
NCBI-ProteinID: XP_016072486
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEATLMEYLENPKKYIPGTKMIFASIKKSAERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag
acaggtcaggcccctggattttcttacaccgatgccaacaagaacaaaggcatcacctgg
ggagaggctacactgatggagtatttggagaatcccaagaagtatatccctggaacaaaa
atgatcttcgccagcattaagaagagtgcagaaagggcagacttgatagcttatctcaaa
aaagccactaatgagtaa

DBGET integrated database retrieval system