KEGG   Miniopterus natalensis: 107533280
Entry
107533280         CDS       T05883                                 

Gene name
LDLR
Definition
(RefSeq) low-density lipoprotein receptor isoform X1
  KO
K12473  low-density lipoprotein receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04144  Endocytosis
mna04913  Ovarian steroidogenesis
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna04976  Bile secretion
mna04979  Cholesterol metabolism
mna05145  Toxoplasmosis
mna05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107533280 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107533280 (LDLR)
   04925 Aldosterone synthesis and secretion
    107533280 (LDLR)
   04927 Cortisol synthesis and secretion
    107533280 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    107533280 (LDLR)
   04979 Cholesterol metabolism
    107533280 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107533280 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107533280 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107533280 (LDLR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107533280 (LDLR)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    107533280 (LDLR)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL EGF hEGF
Other DBs
NCBI-GeneID: 107533280
NCBI-ProteinID: XP_016063369
LinkDB
Position
Unknown
AA seq 832 aa
MRLCWFLALLLTAEVAAAEDKCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCKS
VTCRLEDFACGGRVNRCIPEFWRCDGQVDCENGSDEQGCSPKTCSQDEFRCHDGKCIAPD
FVCDTDRDCLDGSDEESCPPPTCGPASFQCNSSSCIPALWACDSDPDCDDGSDEWPQHCG
GRNTSAKHLDKPCLALEFHCRSGECIHPSWRCDGSPDCKDKSDEENCAVATCRPDEFQCL
DGTCIHGSQQCDREHDCKDMSDELGCINVTVCKGPNKFKCHSGECIPMDKVCNSVRDCRD
WSDEPIKECGTNECLDKKGGCSHICKDLKIGHECLCPEGFQLADPLRCEDIDECQDPGAC
SQLCVNLEGSYKCECEEGFQLDPVTKACKAVGTIAYLFFTNRHEVRKMTLDRSEYTSLIP
NLKNVVALDMEVAGNRIYWSDLSLRKIYSTQIDRVPSSSYDTVIEEDLQAPDGLAVDWIH
SNIYWTDSILGTVSVADTKGVKRKTLFQEKDCKPRAIVVDPVHGFMYWTDWGTPAKIKKG
GLNGVDIHSLVTEDIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGRNRKTILEDKRRL
AHPFSLAIFEDKVFWTDIINEAIFSANRLTGSDIHLMAENLVSPEDIVLFHNLIQPRGVN
WCEKTTLPNGGCQYLCLPAPQINPHSPKFTCACPDGMLLAEDKRSCVPDTEPVVTTRGAT
MGHSTVAIPELTTTKMVTKPHQAPGDMPIRVDEERPRSASALYIVLPIALLTLLCFGTFL
VWKNWRLKSINSINFDNPVYQKTTEDEVHICHSQDGYTYPSRQMVRMEDDMA
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgaggctgtgctggttcctcgccctgctcctcaccgcggaggtagctgcagcggaagac
aaatgtgagagaaatgagttccagtgccaggacgggaaatgcatctcctacaagtgggtt
tgtgatgggagtgccgagtgccaggacggctctgatgagtcccaggagacatgcaagtct
gtcacctgcaggctagaggacttcgcctgtgggggtcgtgttaaccgctgtattcctgag
ttctggagatgtgatggccaggtggactgcgagaatggctccgacgagcaaggctgttcc
cccaagacctgttcccaggacgagttccgctgccacgatggcaagtgcatcgcccccgac
ttcgtctgcgacaccgaccgagactgcttggacggctcggacgaggagtcctgccccccg
cccacctgcggccccgccagcttccagtgcaacagctcctcctgcatccctgcgctgtgg
gcctgtgacagcgaccccgactgcgacgatggctcggacgagtggccgcagcactgcggg
ggccgcaacacgtcggccaagcacctggacaagccctgcctggccctcgagttccactgc
cgcagcggcgagtgcatccacccgagctggcgctgcgacggcagccccgactgcaaggac
aagtctgacgaggagaactgcgctgtggccacatgccggccagatgagttccagtgcttg
gatgggacctgcatccatggcagccagcagtgtgacagggagcatgactgtaaggacatg
agtgatgagcttggctgcatcaatgtgactgtgtgcaagggccccaacaagttcaagtgc
cacagtggtgaatgcatccccatggacaaagtgtgcaactcggtccgagactgccgggac
tggtcggatgagcccatcaaggagtgtgggaccaacgagtgcctggacaaaaagggcggc
tgctctcacatctgcaaagacctcaagattggccatgagtgcttgtgtcccgagggcttc
cagctggcggacccgctaagatgtgaagatatcgacgagtgtcaggaccccggcgcctgc
agccaactctgtgtgaaccttgagggcagctataagtgcgagtgtgaagagggcttccag
ctggaccccgtcaccaaggcctgcaaggctgtgggcaccatcgcctacctctttttcacc
aaccgccacgaggtgaggaagatgacgctggaccgcagtgaatacaccagcctcatcccc
aacctgaagaatgtggtcgccctggacatggaagtggccggcaacagaatctactggtcg
gacttgtccctaaggaagatctacagcacccagatcgacagagtgcccagctcctcctac
gacactgtcatcgaggaggacctccaggcccccgacgggctggcagtggactggatccac
agcaacatttactggaccgactccatcctgggcaccgtctctgtggctgacaccaagggt
gtgaagagaaagaccctgttccaggagaaagactgcaagccaagggccattgtggtggat
cccgttcatggtttcatgtactggacagactgggggactcctgccaagatcaagaagggg
ggcctgaacggtgtggacattcactcactggtgacagaggacatccagtggcccaatgga
atcaccctggatctttccagtggccgcctctactgggttgactccaagctccactccatc
tccagcatcgatgtcaatgggaggaaccggaagacaattttggaggacaagagaaggctg
gcacaccccttctccttggccatctttgaggataaagtattttggacggatatcatcaac
gaagccattttcagcgccaaccgtctcacagggtccgacattcatttgatggcagaaaac
ctggtgtccccagaggacatcgtccttttccacaacctcatacagccaagaggggtgaac
tggtgtgagaagaccacccttcccaacggtggctgccagtacctgtgtctgccggccccg
cagatcaatccccactcacccaagttcacctgtgcctgccccgatggcatgctgctggct
gaggacaagaggagctgcgtcccagacactgaacctgttgtgaccacccggggagccacc
atgggtcattcaactgtggccattcctgagctcaccaccaccaagatggtgaccaagccc
caccaagccccaggtgacatgcctatcagagtggacgaggagaggccccggagtgcgagc
gcgctgtacattgtcctccccatcgcgctgcttaccctcctgtgcttcgggaccttcctc
gtctggaagaactggcgactgaagagcatcaacagcatcaactttgacaaccccgtgtac
cagaagaccacggaggacgaggtccacatctgccacagccaggatggctacacctacccc
tcgagacagatggtcaggatggaggatgacatggcataa

DBGET integrated database retrieval system