KEGG   Miniopterus natalensis: 107533363
Entry
107533363         CDS       T05883                                 

Gene name
GNG13
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
  KO
K04547  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107533363 (GNG13)
   04371 Apelin signaling pathway
    107533363 (GNG13)
   04151 PI3K-Akt signaling pathway
    107533363 (GNG13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107533363 (GNG13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107533363 (GNG13)
  09156 Nervous system
   04724 Glutamatergic synapse
    107533363 (GNG13)
   04727 GABAergic synapse
    107533363 (GNG13)
   04725 Cholinergic synapse
    107533363 (GNG13)
   04728 Dopaminergic synapse
    107533363 (GNG13)
   04726 Serotonergic synapse
    107533363 (GNG13)
   04723 Retrograde endocannabinoid signaling
    107533363 (GNG13)
  09157 Sensory system
   04740 Olfactory transduction
    107533363 (GNG13)
   04742 Taste transduction
    107533363 (GNG13)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107533363 (GNG13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107533363 (GNG13)
  09165 Substance dependence
   05032 Morphine addiction
    107533363 (GNG13)
   05034 Alcoholism
    107533363 (GNG13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107533363 (GNG13)
   05163 Human cytomegalovirus infection
    107533363 (GNG13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107533363 (GNG13)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107533363 (GNG13)
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 107533363
NCBI-ProteinID: XP_016063500
LinkDB
Position
Unknown
AA seq 67 aa
MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCAIL
NT seq 204 nt   +upstreamnt  +downstreamnt
atggaggagtgggacgtgccccagatgaagaaggaggtcgagagcctcaagtaccagctg
gccttcaaaagggagatgtcatccaagaccatccctgagctcctcaagtggatcgaggat
gggatccccaaggaccccttcctgaaccctgacctcatgaagaacaacccgtgggtggag
aagggcaagtgtgccatcctgtga

KEGG   Miniopterus natalensis: 107533994
Entry
107533994         CDS       T05883                                 

Gene name
GNAL
Definition
(RefSeq) guanine nucleotide-binding protein G(olf) subunit alpha
  KO
K04633  guanine nucleotide-binding protein G(olf) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna05012  Parkinson disease
mna05142  Chagas disease
mna05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107533994 (GNAL)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    107533994 (GNAL)
  09157 Sensory system
   04740 Olfactory transduction
    107533994 (GNAL)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107533994 (GNAL)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107533994 (GNAL)
   05142 Chagas disease
    107533994 (GNAL)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    107533994 (GNAL)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU Roc Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 107533994
NCBI-ProteinID: XP_016064420
LinkDB
Position
Unknown
AA seq 380 aa
MGCLGNSKTTEDQGVDEKERREANKKIEKQLQKEXXXXXXXXXCLFVGAGESGKSTIVKQ
MRILHVNGFNPEEKKQKILDIRKNVKDAIVTIISAMSTIIPPVPLANPENQFRSDYIKSI
APITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTD
QDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSYN
MVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPE
YANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRR
VFNDCRDIIQRMHLKQYELL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgggctgtctgggcaacagcaagaccacggaagaccagggcgtcgacgaaaaagaaagg
cgcgaggccaacaagaagatcgagaagcagctgcagaaggagnnnnnnnnnnnnnnnnnn
nnnnnnntctgtttgtttgtaggggctggtgagtccgggaaaagcactatcgtcaaacag
atgaggatcctgcacgtcaatggatttaatcccgaggaaaagaagcagaaaattctggac
atccggaagaatgttaaagatgctattgtgacgataatttcagcaatgagtaccataata
cctccagtcccactggccaacccagaaaatcagtttcgatccgactatatcaagagtata
gcccctatcacggactttgaatattcccaggaattctttgatcacgtgaagaaactttgg
gacgacgaaggcgtgaaggcgtgctttgagaggtcgaacgagtaccagctgatcgactgc
gcgcaatacttcctggagagaatcgacagcgtcagcttggtggactacacccccacagac
caggaccttctcagatgcagagttctgacctcagggatttttgagacacggttccaagtg
gacaaagtcaactttcacatgttcgatgtcggcggccagagggatgagagaaggaaatgg
atccagtgctttaacgacgtcaccgctatcatttacgtggcggcctgcagtagctacaac
atggtcattcgggaagataacaacaccaacaggctgagggagtccctggaccttttcgaa
agcatctggaacaacaggtggttgcgtaccatttctatcatcttgttcttgaacaaacaa
gatatgctggcagaaaaagtcttggcagggaaatcaaaaattgaagattatttcccagag
tatgcaaattacactgttcctgaagatgcgacaccagatgcgggagaagatcccaaagtt
acaagagccaagttcttcataagggatctgtttttgaggatcagcacggcgaccggggac
ggcaagcactactgctacccacacttcacctgcgccgtggacacggagaacatccgcagg
gtgttcaatgactgccgcgacatcatccagaggatgcacctcaagcagtacgaactcttg
tga

KEGG   Miniopterus natalensis: 107534609
Entry
107534609         CDS       T05883                                 

Gene name
GNG7
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
  KO
K04543  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107534609 (GNG7)
   04371 Apelin signaling pathway
    107534609 (GNG7)
   04151 PI3K-Akt signaling pathway
    107534609 (GNG7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107534609 (GNG7)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107534609 (GNG7)
  09156 Nervous system
   04724 Glutamatergic synapse
    107534609 (GNG7)
   04727 GABAergic synapse
    107534609 (GNG7)
   04725 Cholinergic synapse
    107534609 (GNG7)
   04728 Dopaminergic synapse
    107534609 (GNG7)
   04726 Serotonergic synapse
    107534609 (GNG7)
   04723 Retrograde endocannabinoid signaling
    107534609 (GNG7)
  09157 Sensory system
   04740 Olfactory transduction
    107534609 (GNG7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107534609 (GNG7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107534609 (GNG7)
  09165 Substance dependence
   05032 Morphine addiction
    107534609 (GNG7)
   05034 Alcoholism
    107534609 (GNG7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107534609 (GNG7)
   05163 Human cytomegalovirus infection
    107534609 (GNG7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107534609 (GNG7)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107534609 (GNG7)
  Exosomal proteins of other body fluids (saliva and urine)
   107534609 (GNG7)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    107534609 (GNG7)
SSDB
Motif
Pfam: G-gamma CP12 FtsX_ECD
Other DBs
NCBI-GeneID: 107534609
NCBI-ProteinID: XP_016065255
LinkDB
Position
Unknown
AA seq 68 aa
MSATNNIAQARKLVEQLRIEAGIQRIKVSKASSELMSYCEQHARNDPLLVGVPASENPFK
DKKPCVIL
NT seq 207 nt   +upstreamnt  +downstreamnt
atgtcagccactaacaacatcgcccaggccaggaaactggtggagcagctccgcatcgaa
gccgggatccagcgcatcaaggtctccaaagcctcatcggaactcatgagttactgtgag
cagcatgcccggaacgaccccctgctggtcggagtccctgcctccgagaaccccttcaag
gacaagaagccttgtgtcattctatag

KEGG   Miniopterus natalensis: 107540160
Entry
107540160         CDS       T05883                                 

Gene name
GNB1
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
  KO
K04536  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04062  Chemokine signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04371  Apelin signaling pathway
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04744  Phototransduction
mna04926  Relaxin signaling pathway
mna05032  Morphine addiction
mna05034  Alcoholism
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107540160 (GNB1)
   04371 Apelin signaling pathway
    107540160 (GNB1)
   04151 PI3K-Akt signaling pathway
    107540160 (GNB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107540160 (GNB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107540160 (GNB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107540160 (GNB1)
   04727 GABAergic synapse
    107540160 (GNB1)
   04725 Cholinergic synapse
    107540160 (GNB1)
   04728 Dopaminergic synapse
    107540160 (GNB1)
   04726 Serotonergic synapse
    107540160 (GNB1)
   04723 Retrograde endocannabinoid signaling
    107540160 (GNB1)
  09157 Sensory system
   04744 Phototransduction
    107540160 (GNB1)
   04740 Olfactory transduction
    107540160 (GNB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107540160 (GNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540160 (GNB1)
  09165 Substance dependence
   05032 Morphine addiction
    107540160 (GNB1)
   05034 Alcoholism
    107540160 (GNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107540160 (GNB1)
   05163 Human cytomegalovirus infection
    107540160 (GNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107540160 (GNB1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107540160 (GNB1)
  Exosomal proteins of colorectal cancer cells
   107540160 (GNB1)
  Exosomal proteins of melanoma cells
   107540160 (GNB1)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    107540160 (GNB1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A Cytochrom_D1 CALM_bind
Other DBs
NCBI-GeneID: 107540160
NCBI-ProteinID: XP_016072336
LinkDB
Position
Unknown
AA seq 340 aa
MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNVDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF
TGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRADQELMIYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL
KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtgagcttgaccagctgcggcaggaggccgagcagctgaaaaaccagatccgagat
gccaggaaagcatgtgcagatgcaacactctctcagatcacaaacaacgtggaccctgtg
ggaaggatccagatgcgcaccaggagaacgctgcgggggcacctggccaaaatctacgct
atgcactggggcacagattccaggcttctcgtgagtgcctctcaggatggtaaactcatc
atctgggacagctacaccacaaacaaggtccacgctattcctctgcgctcctcgtgggtc
atgacctgtgcgtatgccccttctgggaactacgtggcctgtggtggcctggataacatt
tgctccatttacaacctgaagactcgcgaaggaaatgtgcgtgtgagtcgtgaactagcc
ggacacacaggttacctgtcctgctgccgcttcctggacgacaatcagattgttaccagc
tctggagacaccacctgtgctctgtgggacattgagacgggtcagcagacgaccacgttc
acgggacacaccggggacgtcatgagcctctctctcgctcctgacaccaggctgtttgtg
tccggtgcttgtgatgcttccgctaaactctgggatgtgcgagaagggatgtgccggcaa
accttcaccggccacgagtctgacatcaatgccatctgtttctttccaaatggcaacgca
tttgccactggctcggatgacgccacctgcaggctgttcgaccttcgtgcggatcaggag
ctcatgatttactcccacgacaacatcatatgtgggatcacctccgtctccttctccaag
agtgggcgcctcctcctcgcggggtacgatgacttcaactgcaacgtctgggatgcgctc
aaagccgacagggcaggtgtcttggccgggcatgacaaccgcgtcagctgcctgggggtg
actgacgatgggatggccgtggcgacagggtcctgggatagcttcctcaagatctggaac
taa

DBGET integrated database retrieval system