KEGG   Miniopterus natalensis: 107533364
Entry
107533364         CDS       T05883                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03320  PPAR signaling pathway
mna04068  FoxO signaling pathway
mna04071  Sphingolipid signaling pathway
mna04140  Autophagy - animal
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04210  Apoptosis
mna04510  Focal adhesion
mna04660  T cell receptor signaling pathway
mna04664  Fc epsilon RI signaling pathway
mna04722  Neurotrophin signaling pathway
mna04910  Insulin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04931  Insulin resistance
mna04960  Aldosterone-regulated sodium reabsorption
mna05145  Toxoplasmosis
mna05205  Proteoglycans in cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05223  Non-small cell lung cancer
mna05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107533364 (PDPK1)
   04071 Sphingolipid signaling pathway
    107533364 (PDPK1)
   04151 PI3K-Akt signaling pathway
    107533364 (PDPK1)
   04152 AMPK signaling pathway
    107533364 (PDPK1)
   04150 mTOR signaling pathway
    107533364 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107533364 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    107533364 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107533364 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107533364 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    107533364 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107533364 (PDPK1)
   03320 PPAR signaling pathway
    107533364 (PDPK1)
   04919 Thyroid hormone signaling pathway
    107533364 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107533364 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107533364 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107533364 (PDPK1)
   05231 Choline metabolism in cancer
    107533364 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107533364 (PDPK1)
   05213 Endometrial cancer
    107533364 (PDPK1)
   05223 Non-small cell lung cancer
    107533364 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107533364 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107533364 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107533364 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107533364 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107533364 (PDPK1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107533364 (PDPK1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   107533364 (PDPK1)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    107533364 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 107533364
NCBI-ProteinID: XP_016063502
LinkDB
Position
Unknown
AA seq 552 aa
MKYDTVPIQSSVVLCSCPSPSMVRTQTESGTAPVVPSGGSRQGPTMDSTAAESRPSANSL
QHAVQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKV
PYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRF
YTAEMVSALEYLHGRGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVG
TAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEK
FFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHSFFESITWENLHHQTPPKLTAYLPA
MSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRAGSNIEQYIHDLDTNSF
ELDLQFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHL
YYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWR
HRYQSHPDAAVQ
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgaagtatgacaccgttcctattcagtccagtgtggtgttatgttcctgcccatcccca
tcaatggtgaggacccagactgagtccggaacggcccctgttgttcctagcggtggtagc
aggcagggccccaccatggacagcactgcggccgagtccagaccaagtgccaactctctg
caacatgctgtacagccaccaccacagcctcggaaaaaacgacctgaagacttcaaattt
gggaaaatacttggtgaaggctctttttcaacagttgtcctggcccgagaactggcaacc
tcaagagaatatgctattaaaattctagagaaacgtcacattatcaaagagaacaaggtc
ccgtatgtaaccagagagagagacgtgatgtcgcgcctggatcaccccttctttgttaaa
ctttacttcacgtttcaggatgatgaaaagctgtattttggccttagttatgccaaaaat
ggagaactacttaaatatattcgcaaaattggttcattcgatgagacgtgcacccgattt
tacacagctgagatggtgtctgctctagagtacttgcatggcaggggcatcattcacagg
gacctgaaaccagaaaacattttgttaaatgaagatatgcacatccagatcacagatttt
ggaacagcaaaagtattatccccagagagtaaacaagccagggccaactcgtttgtaggc
acagcccagtatgtttctccagagctgctcacagagaaatcggcctgtaaaagttcagac
ctttgggctcttggatgtataatataccaacttgtggcaggactcccaccattccgagca
ggaaacgaatatcttatatttcagaagatcattaagttggagtatgactttcctgaaaaa
ttctttcctaaggcaagagaccttgtggaaaaacttttggttttagatgccacaaagcga
ttaggctgtgaagaaatggaggggtacggccctctgaaagcccattcattctttgagtcc
atcacgtgggagaatctgcatcatcagacacctccgaaactcacagcttacttaccagcc
atgtcggaagatgatgaagactgctatggaaactacgacaatctcctgagccagtttggc
tgcatgcaggtgtcatcgtcatcatcttcccactccctgtctgcctcagacacgggtctg
ccgcagagggcaggcagcaacatcgagcagtatatccatgacctggacactaattctttt
gaactggacttacagttttctgaagatgagaagaggttattattggagaagcaggccagt
ggaaacccttggcaccagtttgtagaaaataatttaatactaaaaatgggtccagtagat
aagcgaaagggtttatttgcacgacgacgacaattactactcacagaagggccacactta
tattatgtggatcctgtcaacaaagtcctgaaaggtgaaattccatggtcacaagaactc
cgaccagaggccaagaattttaaaaccttctttgtccacacaccaaacaggacatattac
ctgatggacccgagtgggaatgctcacaaatggtgcaaaaagattcaggaggtgtggagg
cacagataccagagccacccagatgccgccgtgcagtga

DBGET integrated database retrieval system