KEGG   Miniopterus natalensis: 107533393
Entry
107533393         CDS       T05883                                 

Gene name
IGFALS
Definition
(RefSeq) insulin-like growth factor-binding protein complex acid labile subunit
  KO
K17256  insulin-like growth factor-binding protein complex acid labile subunit
Organism
mna  Miniopterus natalensis
Pathway
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107533393 (IGFALS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107533393 (IGFALS)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107533393 (IGFALS)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 107533393
NCBI-ProteinID: XP_016063557
LinkDB
Position
Unknown
AA seq 632 aa
MCRLRPEVSTSLSLRGSHPEPLNATSPQTPFPTGGLALAVLLISWAALGPCGLEGVEPGV
PGDTEGLQCPAICTCGHDDYTDELSVFCSSRNLTQLPGGIPDSARALWLDGNNFSSIPEA
AFRNLSSLGFLNLQGSGLASLEPKALLGLQNLYHLHLERNQLRGLAARTFLHTPGLASLG
LNNNLLSRVDEGLFHGLANLWDLNLGWNSLAVLPDTVFQGLANLRELVLASNKLTYLQPQ
LFHGLSELRELDLSRNALRSIKANIFVKLPKLQKLYLDHNHITAVAPGAFLGLKALRWLD
LSHNRVGSLLEDTFPGLLGLHVLRLSHNTIASLRPRAFKDLHFLEELRLGHNRLRQLPDK
AFEGLGQLEVLTLNDNQIQEVKAGAFFGLLNLAVMNLSGNCLRNLPVRVFQGLAKLHSLH
LEGSCLGRIRQHTFAGLSGLRRLFLKNNGITAIEEQSLWGLPDLLELDLTSNQLMQLPSQ
LFQGLGKLEYLLLSRNRLSTLSAEVLGPLQCTFWLDISHNHLEALPESILLPLRQLRYLS
LRNNSLRTFVPQPPGLERLWLEGNPWHCGCPLRALRVFALQHPTVVPRFVQAIPEGDCQP
PMYTYNNITCASPPSILGLDLRDVGEDHFAHC
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgtgcaggcttaggcctgaagtttccacgtctctctcactccggggttcacatcccgag
cccctcaatgccacctctccccaaactcctttccctacaggaggcctggccctggcagtg
ctgctgatctcctgggcagcattgggtccctgtggcctggagggagtggagcctggagtg
ccaggggacactgagggcctgcagtgcccggccatctgtacctgcggccacgacgactac
acggatgagctcagcgtcttctgcagctcccggaaccttacacagctgcccggcggcatc
ccagacagtgccagggccctgtggctggatggcaataacttctcctccatccccgaggca
gcctttcggaacctctccagcctgggcttcctcaatctccagggcagtgggctggccagc
ctggagccgaaggcactgctgggcctgcagaacctgtaccacctgcacctggagcggaac
cagctgcgcggccttgcggcccgcaccttcctgcacacaccaggtctcgcctcacttggc
ctcaacaacaacctcctcagcagagtggatgagggcctcttccacggcctggccaacctc
tgggacctcaaccttggctggaacagcctggccgtgctccctgacaccgtgttccagggt
ctggccaatctgcgcgagctggtgcttgcaagcaacaagctgacctacctgcagccccaa
ctcttccatggcctcagcgagctccgggagctggatctgagcaggaacgccttgcgaagc
atcaaggccaacatctttgtcaagctgcccaagctccagaagctgtacctggaccacaac
catatcaccgctgtggctccgggtgctttcctgggcctgaaagcactgcgttggctggac
ctgtcacacaaccgtgtgggcagcctcctggaagacaccttcccaggcctgctgggcctg
cacgtcctgcgcctctcacacaacactatcgccagcctgcgaccccgggccttcaaggac
ctgcacttcctggaagagctgcggctgggccacaaccgcctccggcagctgccggacaag
gcctttgagggcctgggccagctggaggtgctcacactcaatgacaaccagatccaggaa
gtcaaggcgggggccttcttcggcctcttgaacctggccgtcatgaacctctctggcaat
tgtctgcggaaccttccagtgcgagtgttccagggcctggccaagctgcacagcctgcac
ctggaaggcagctgcctgggccgcatccgccagcacaccttcgccggcctctcggggctt
cgccgactctttctcaaaaacaatggcatcacggccatcgaggaacagagcctgtggggg
ctccctgacctcctggagctggacctcacctcaaaccagctcatgcaactgcccagtcag
ctcttccagggccttgggaagctggaatacttgctcctgtcccgcaaccggctgtctaca
ctgtcagcagaagtcctggggcccctgcaatgcaccttctggctagacatctcgcacaac
cacctggaggccctgcccgagagcatccttttgccactgaggcagctgcgctacctcagc
ctcaggaacaactcgttgcggacctttgtgccacagcctcctggcctagagcgcctatgg
ctggagggcaatccctggcactgtggctgccctctccgggccctgagggtctttgccctg
cagcaccccactgtcgtgccccgctttgtccaagccatcccggaaggagactgccagcca
cccatgtatacctacaacaacatcacctgtgccagcccccccagcatcttgggacttgac
ctacgtgatgttggtgaggaccactttgctcactgctga

DBGET integrated database retrieval system